MORC3 Protein, Human (His-SUMO)
MORC3 protein is a nuclear matrix protein that forms MORC3-NB through an ATP-dependent mechanism to restrict viruses through IFN response regulation, which is critical for innate immunity.It regulates IFNB1 activation and has secondary IFN inhibitory functions.MORC3 Protein, Human (His-SUMO) is the recombinant human-derived MORC3 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MORC3 protein is a nuclear matrix protein that forms MORC3-NB through an ATP-dependent mechanism to restrict viruses through IFN response regulation, which is critical for innate immunity.It regulates IFNB1 activation and has secondary IFN inhibitory functions.MORC3 Protein, Human (His-SUMO) is the recombinant human-derived MORC3 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
Background
MORC3 Protein, a nuclear matrix protein, orchestrates the formation of MORC3-NBs (nuclear bodies) through an ATP-dependent mechanism, playing a crucial role in innate immunity by restricting various viruses through modulation of the IFN response. Its primary antiviral function involves the regulation of an IFN-responsive element that activates IFNB1, safeguarded by a secondary IFN-repressing function. Sumoylated MORC3-NBs interact with PML-NBs, recruiting TP53 and SP100, thereby regulating TP53 activity. Additionally, MORC3 demonstrates in vitro RNA binding capability. Serving as a histone methylation reader, MORC3 binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2), and trimethylated (H3K4me3) 'Lys-4' on histone H3, with a preference order of H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0. In the context of microbial infection, MORC3 may be essential for influenza A transcription during viral infection.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q14149 (M1-Y290)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
MORC3 (M1-Y290)
Accession # Q14149 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MORC3; Zinc Finger, CW Type With Coiled-Coil Domain 3; Prev. ZCWCC3; Nuclear Matrix Protein 2; NXP2; Zinc Finger, CW-Type With Coiled-Coil Domain 3; KIAA0136; Nuclear Matrix Protein NXP2; ZCW5; MORC3 Protein; Zinc Finger CW-Type Coiled-Coil Domain Protein
-
AA Sequence
MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
-
Predicted Molecular Mass
48.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
