MORC3 Protein, Human (His-SUMO)

MORC3 protein is a nuclear matrix protein that forms MORC3-NB through an ATP-dependent mechanism to restrict viruses through IFN response regulation, which is critical for innate immunity. It regulates IFNB1 activation and has secondary IFN inhibitory functions. MORC3 Protein, Human (His-SUMO) is the recombinant human-derived MORC3 protein, expressed by E. coli , with N-His, N-SUMO labeled tag. The total length of MORC3 Protein, Human (His-SUMO) is 290 a.a., with molecular weight of ~48.7 kDa.

MORC3 Protein, a nuclear matrix protein, orchestrates the formation of MORC3-NBs (nuclear bodies) through an ATP-dependent mechanism, playing a crucial role in innate immunity by restricting various viruses through modulation of the IFN response. Its primary antiviral function involves the regulation of an IFN-responsive element that activates IFNB1, safeguarded by a secondary IFN-repressing function. Sumoylated MORC3-NBs interact with PML-NBs, recruiting TP53 and SP100, thereby regulating TP53 activity. Additionally, MORC3 demonstrates in vitro RNA binding capability. Serving as a histone methylation reader, MORC3 binds to non-methylated (H3K4me0), monomethylated (H3K4me1), dimethylated (H3K4me2), and trimethylated (H3K4me3) 'Lys-4' on histone H3, with a preference order of H3K4me3 > H3K4me2 > H3K4me1 > H3K4me0. In the context of microbial infection, MORC3 may be essential for influenza A transcription during viral infection.

Human

E. coli

N-His;N-SUMO

Q14149 (1M-290Y)

23515  [NCBI]

MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY

Approximately 48.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.