MPZL1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
MPZL1, a cell surface receptor intricately involved in signal transduction processes, plays a pivotal role in recruiting PTPN11/SHP-2 to the cell membrane, establishing itself as a putative substrate for PTPN11/SHP-2. As a major receptor for concanavalin-A (ConA), MPZL1 contributes to cellular signaling induced by ConA, likely involving Src family tyrosine-protein kinases. The isoform 3 variant appears to exert a dominant negative effect, inhibiting the tyrosine phosphorylation of MPZL1 induced by ConA. Notably, isoform 1, distinct from isoform 2 and isoform 3, is implicated in the regulation of integrin-mediated cell motility. The receptor also engages in interactions with phosphorylated PTPN11/SHP-2, underscoring its multifaceted involvement in signal transduction cascades.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
O95297 (S36-V162)
-
Molecular Construction
-
N-term
-
MPZL1 (S36-V162)
Accession # O95297 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
MPZL1; Myelin Protein Zero-Like 1, Isoform CRA_b; Myelin Protein Zero Like 1; Protein Zero Related; PZR; Protein Zero-Related; Myelin Protein Zero-Like Protein 1; MPZL1b; FLJ21047; PZR1b; CDNA FLJ78597, Highly Similar To Homo Sapiens Myelin Protein Zero-L
-
AA Sequence
SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPV
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
