1. Recombinant Proteins
  2. Receptor Proteins
  3. MPZL1 Protein, Human (HEK293, His)

MPZL1 Protein, Human (HEK293, His)

Cat. No.: HY-P70220
COA Handling Instructions

MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of MPZL1 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of 20-28 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $50 In-stock
50 μg $105 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MPZL1 protein is a cell surface receptor that participates in signal transduction by recruiting PTPN11/SHP-2 to the cell membrane. MPZL1 Protein, Human (HEK293, His) is the recombinant human-derived MPZL1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of MPZL1 Protein, Human (HEK293, His) is 127 a.a., with molecular weight of 20-28 kDa.

Background

MPZL1, a cell surface receptor intricately involved in signal transduction processes, plays a pivotal role in recruiting PTPN11/SHP-2 to the cell membrane, establishing itself as a putative substrate for PTPN11/SHP-2. As a major receptor for concanavalin-A (ConA), MPZL1 contributes to cellular signaling induced by ConA, likely involving Src family tyrosine-protein kinases. The isoform 3 variant appears to exert a dominant negative effect, inhibiting the tyrosine phosphorylation of MPZL1 induced by ConA. Notably, isoform 1, distinct from isoform 2 and isoform 3, is implicated in the regulation of integrin-mediated cell motility. The receptor also engages in interactions with phosphorylated PTPN11/SHP-2, underscoring its multifaceted involvement in signal transduction cascades.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O95297 (S36-V162)

Gene ID
Molecular Construction
N-term
MPZL1 (S36-V162)
Accession # O95297
6*His
C-term
Synonyms
rHuMyelin protein zero-like protein 1/MPZL1, His; Myelin protein zero-like 1; isoform CRA_b; cDNA FLJ78597; highly similar to Homo sapiens myelin protein zero-like 1 (MPZL1); transcript variant 1; mRNA ; cDNA; FLJ96614; Homo sapiens myelin protein zero-like 1 (MPZL1); Mrna
AA Sequence

SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPV

Molecular Weight

20-28 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MPZL1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MPZL1 Protein, Human (HEK293, His)
Cat. No.:
HY-P70220
Quantity:
MCE Japan Authorized Agent: