MUC-17 Protein, Human (HEK293, His)

MUC-17 protein maintains mucosal homeostasis, contributing to environmental stability. Interacting via its C-terminus, MUC-17 crucially associates with PDZK1, ensuring proper cellular localization. MUC-17 Protein, Human (HEK293, His) is the recombinant human-derived MUC-17 protein, expressed by HEK293, with C-His labeled tag. The total length of MUC-17 Protein, Human (HEK293, His) is 260 a.a., with molecular weight of ~20-35 kDa.

MUC-17 protein likely functions in maintaining homeostasis on mucosal surfaces, contributing to the stability and equilibrium of these environments. Through interactions facilitated by its C-terminus, MUC-17 engages with PDZK1, and this association is crucial for its proper localization within the cellular context.

Immobilized  Human MUC-17 at 2 μg/mL (100 μL/well) can bind Anti- MUC-17 Antibody, The  ED₅₀ for this effect is ≤11.32 ng/mL.

Human

HEK293

C-His

Q685J3-1 (R4131-L4390)

140453  [NCBI]

RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL

Approximately 20-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.