1. Recombinant Proteins
  2. Others
  3. MZB1/PERP1 Protein, Human (HEK293, Fc)

MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, Fc) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The MZB1/PERP1 Protein associates with immunoglobulin M (IgM) heavy and light chains, facilitating the assembly and secretion of IgM. Its influence may stem from its role as a molecular chaperone or an oxidoreductase, given its demonstrated low level of oxidoreductase activity (By similarity). Isoform 2 potentially participates in the regulation of apoptosis. Moreover, MZB1/PERP1 contributes to the diversification of peripheral B-cell functions by overseeing Ca(2+) stores, antibody secretion, and integrin activation. Acting as a hormone-regulated adipokine and pro-inflammatory cytokine, it is implicated in chronic inflammation, influencing cellular expansion and blunting insulin response in adipocytes. Additionally, MZB1/PERP1 may play a role in the onset of insulin resistance.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8WU39-1 (D23-T185)

Gene ID
Molecular Construction
N-term
MZB1 (D23-T185)
Accession # Q8WU39-1
hFc
C-term
Protein Length

Partial

Synonyms
Marginal zone B- and B1-cell-specific protein; MEDA7; PACAP
AA Sequence

DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT

Predicted Molecular Mass
44.9 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

MZB1/PERP1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

MZB1/PERP1 Protein, Human (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
MZB1/PERP1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77094
수량:
MCE Japan Authorized Agent: