1. Recombinant Proteins
  2. Others
  3. nAChRα5 Protein, Human (HEK293, His)

The nAChRα5 protein induces significant conformational changes in all subunits upon acetylcholine binding, leading to the opening of ion-conducting channels in the plasma membrane. nAChRα5, composed of α and non-α (β) subunits, interacts with LYPD6 to reveal complex regulatory mechanisms in neuronal acetylcholine receptors. nAChRα5 Protein, Human (HEK293, His) is the recombinant human-derived nAChRα5 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The nAChRα5 protein induces significant conformational changes in all subunits upon acetylcholine binding, leading to the opening of ion-conducting channels in the plasma membrane. nAChRα5, composed of α and non-α (β) subunits, interacts with LYPD6 to reveal complex regulatory mechanisms in neuronal acetylcholine receptors. nAChRα5 Protein, Human (HEK293, His) is the recombinant human-derived nAChRα5 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Upon acetylcholine binding, nAChRα5 Protein initiates a substantial conformational change that influences all subunits, ultimately resulting in the opening of an ion-conducting channel across the plasma membrane. The neuronal AChR is evidently comprised of two distinct types of subunits: the alpha subunits and the non-alpha β subunits. Notably, nAChRα5 Protein engages in interactions with LYPD6, as documented in studies. This molecular interaction sheds light on the intricate regulatory mechanisms underlying the functionality of neuronal acetylcholine receptors, emphasizing the dynamic nature of their conformational changes and their significance in ion channel activation.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P30532/NP_000736.2 (R23-T254)

Gene ID
Molecular Construction
N-term
nAChRα5 (R23-T254)
Accession # P30532
6*His
C-term
Protein Length

Extracellular Domain

Synonyms
rHuNeuronal acetylcholine receptor subunit alpha-5/NACHRA5, His; Neuronal Acetylcholine Receptor Subunit Alpha-5; CHRNA5; NACHRA5
AA Sequence

RCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYT

분자량

35-40 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US;may vary elsewhere.

각종 서류
References

nAChRα5 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

nAChRα5 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
nAChRα5 Protein, Human (HEK293, His)
Cat. No.:
HY-P70340
수량:
MCE Japan Authorized Agent: