NBL1 Protein, Human (HEK293, Fc)

NBL1 protein, identified as a potential tumor suppressor gene in neuroblastoma, plays a crucial role in inhibiting cells from progressing into the critical G1/S stage of the transformation process. Functioning as a homodimer, NBL1 underscores its involvement in regulatory mechanisms governing cellular transformation and emphasizes its potential contributions to maintaining normal cellular growth control. NBL1 Protein, Human (HEK293, Fc) is the recombinant human-derived NBL1 protein, expressed by HEK293 , with C-hFc labeled tag.

NBL1 protein emerges as a potential tumor suppressor gene in neuroblastoma, suggesting its pivotal role in impeding cells from progressing into the critical G1/S stage of the transformation process. Notably, NBL1 functions as a homodimer, highlighting its involvement in regulatory mechanisms that govern cellular transformation and underscoring its potential contributions to the maintenance of normal cellular growth control.

Human

HEK293

C-hFc

P41271 (A17-D181)

100532736  [NCBI]/4681  [NCBI]

Full Length of Mature Protein

AAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED

Approximately 55-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/mcf7-cell.html  [Content Brief]