NEK2 Protein, Human (sf9, GST)

The NEK2 protein is a key kinase that coordinates important events in cell division and chromatin dynamics. In mitotic cells, it critically controls centrosome separation and bipolar spindle formation by phosphorylating CROCC, CEP250 and NINL. NEK2 Protein, Human (sf9, GST) is the recombinant human-derived NEK2 protein, expressed by Sf9 insect cells, with N-GST labeled tag.

NEK2 protein emerges as a pivotal kinase, intricately involved in orchestrating essential events in cell division and chromatin dynamics. In mitotic cells, NEK2 plays a crucial role in controlling centrosome separation and bipolar spindle formation by phosphorylating key centrosomal proteins, including CROCC, CEP250, and NINL, leading to their displacement from centrosomes. NEK2 also regulates kinetochore microtubule attachment stability through the phosphorylation of NDC80 and participates in the mitotic checkpoint by phosphorylating CDC20 and MAD2L1. Moreover, NEK2 actively contributes to chromatin condensation during the first meiotic division through the phosphorylation of HMGA2. Its impact extends to the localization of MAD2L1 to the kinetochore and MAPK1 and NPM1 to the centrosome. NEK2-mediated phosphorylation of CEP68 and CCDC102B further modulates centrosome dynamics, influencing their dissociation and separation during cell division. Additionally, NEK2 phosphorylates and activates NEK11 in G1/S-arrested cells, highlighting its comprehensive role in coordinating various cellular processes critical for accurate cell division.

Human

Sf9 insect cells

N-GST

P51955-1 (M1-I271)

4751

Partial

MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLI

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.