1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Other Kinases
  4. NEK7 NEK
  5. NEK7 Protein, Human (His-SUMO)

The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (His-SUMO) is the recombinant human-derived NEK7 protein, expressed by E. coli , with N-6*His-SUMO labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NEK7 protein is a key kinase that crucially drives mitotic cell cycle progression by enhancing centrosomal microtubule nucleation, ensuring robust spindle formation, and aiding in cytokinesis. Phosphorylation of EML4 at “Ser-146” promotes chromosome aggregation. NEK7 Protein, Human (His-SUMO) is the recombinant human-derived NEK7 protein, expressed by E. coli , with N-6*His-SUMO labeled tag.

Background

NEK7 protein, a pivotal kinase, plays a crucial role in mitotic cell cycle progression by contributing to the microtubule nucleation activity of the centrosome, ensuring robust mitotic spindle formation, and facilitating cytokinesis. Its diverse functions include the phosphorylation of EML4 at 'Ser-146,' promoting dissociation from microtubules during mitosis and thereby facilitating efficient chromosome congression. NEK7 extends its impact beyond mitotic events by phosphorylating RPS6KB1 and serving as an essential activator of the NLRP3 inflammasome assembly. Independently of its kinase activity, NEK7 unlocks NLRP3 within the microtubule organizing center, promoting the formation of the NLRP3:PYCARD complex and activation of CASP1. Notably, NEK7 acts as a cellular switch, ensuring mutual exclusivity between the inflammasome response and cell division; its interaction with NEK9 prevents interaction with NLRP3 and inflammasome activation during mitosis. These multifaceted functions position NEK7 as a key orchestrator in both mitotic progression and the inflammasome response, highlighting its regulatory significance in diverse cellular processes.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-6*His;N-SUMO

Accession

Q8TDX7-1 (M1-S302)

Gene ID

140609

Molecular Construction
N-term
6*His-SUMO
NEK7 (M1-S302)
Accession # Q8TDX7-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Serine/threonine-protein kinase Nek7; NimA-related protein kinase 7; NEK7
AA Sequence

MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDLMDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWKYFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPEKRPDVTYVYDVAKRMHACTASS

Molecular Weight

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NEK7 Protein, Human (His-SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NEK7 Protein, Human (His-SUMO)
Cat. No.:
HY-P701253
Quantity:
MCE Japan Authorized Agent: