NEU2 Protein, Cricetulus griseus (sf9, His-Myc)
The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (sf9, His-Myc) is the recombinant NEU2 protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.
- Species: Others
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The NEU2 protein plays a key role in cellular processes by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. Through its enzymatic activity, NEU2 contributes to the controlled modification of cell surface glycoconjugates, affecting various cellular functions including cell adhesion, signaling, and immune responses. NEU2 Protein, Cricetulus griseus (sf9, His-Myc) is the recombinant NEU2 protein, expressed by sf9 insect cells , with N-10*His, C-Myc labeled tag.
Background
The NEU2 protein is an enzyme that plays a crucial role in sialic acid metabolism by catalyzing the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins, oligosaccharides, and gangliosides. This enzymatic activity contributes to the regulation of cell surface glycoconjugates and cellular interactions. NEU2-mediated desialylation can impact the recognition and function of glycoproteins, influencing processes such as cell adhesion, signaling, and immune responses. The removal of sialic acid by NEU2 is vital for modulating the overall glycan structure and function, with potential implications for various physiological and pathological conditions.
Technical Parameters
-
Species Others
-
Source Sf9 insect cells
-
Tag N-10*His;C-Myc
-
Accession
Q64393 (M1-Q379)
-
Gene ID100689301 [NCBI]
-
Molecular Construction
-
N-term
-
10*His
-
NEU2 (M1-Q379)
Accession # Q64393 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
NEU2; Sialidase 2 (Cytosolic Sialidase); Neuraminidase 2; Cytosolic Sialidase; N-Acetyl-Alpha-Neuraminidase 2; Sialidase-2; SIAL2; Neuraminidase 2 (Cytosolic Sialidase)
-
AA Sequence
MATCPVLQKETLFQTGDYAYRIPALIYLSKQKTLLAFAEKRLTKTDEHADLFVLRRGSYNADTHQVQWQAEEVVTQAYLEGHRSMSPCPLYDKQTRTLFLFFIAVRGQISEHHQLQTGVNVTRLCHITSTDHGKTWSAVQDLTDTTIGSTHQDWATFGVGPGHCLQLRNTAGSLLVPAYAYRKQPPIHAPAPSAFCFLSHDHGSTWELGHFVSQNSLECQVAEVGTGAERVVYLNARSCLGARVQAQSPNSGLDFQDNQVVSKLVEPPKGCHGSVIAFPNPTSKADALDVWLLYTHPTDSRKRTNLGVYLNQKPLDPTTWSAPTLLATGICAYSDLQNMGHGPDGSPQFGCLYESNNYEEIVFLMFTLKQAFPAVFGAQ
-
Predicted Molecular Mass
45.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
