RTN4RL1/NgR3 Protein, Human (395a.a, HEK293, His)

The RTN4RL1/NgR3 protein is a cell surface receptor that functionally affects postnatal brain development and axonal regeneration in the adult central nervous system. It aids in axonal migration across the midline of the brain and formation of the corpus callosum. RTN4RL1/NgR3 Protein, Human (395a.a, HEK293, His) is the recombinant human-derived RTN4RL1/NgR3 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of RTN4RL1/NgR3 Protein, Human (395a.a, HEK293, His) is 395 a.a., with molecular weight of ~63.0 kDa.

RTN4RL1/NgR3, a cell surface receptor, assumes a functionally redundant role in postnatal brain development, exerting regulatory control over axon regeneration in the adult central nervous system. Its contributions encompass guiding axon migration across the brain midline and facilitating the formation of the corpus callosum. Additionally, RTN4RL1 serves a protective function against motoneuronal apoptosis, potentially mediated by MAG. Notably, it plays a crucial role in inhibiting neurite outgrowth and axon regeneration through its interaction with neuronal chondroitin sulfate proteoglycans. The receptor's binding affinity extends to heparin. As observed in its family counterparts, RTN4RL1 participates in shaping dendritic spines and synapse numbers during brain development. Its signaling capability triggers the activation of Rho, culminating in downstream actin cytoskeleton reorganization. RTN4RL1 engages in a complex with RTN4R and NGFR, dependent on the presence of chondroitin sulfate proteoglycans, while displaying no interaction with MAG, OMG, and RTN4.

Human

HEK293

C-6*His

Q86UN2 (C25-A419)

146760  [NCBI]

CPRDCVCYPAPMTVSCQAHNFAAIPEGIPVDSERVFLQNNRIGLLQPGHFSPAMVTLWIYSNNITYIHPSTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGVFGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGPGTFRGLVNLDRLLLHENQLQWVHHKAFHDLRRLTTLFLFNNSLSELQGECLAPLGALEFLRLNGNPWDCGCRARSLWEWLQRFRGSSSAVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQA

Approximately 63.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.