1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Serpin (Protease Inhibitor)
  5. Serpin I1/Neuroserpin
  6. Neuroserpin Protein, Human (CHO)

Neuroserpin Protein, Human (CHO)

Cat. No.: HY-P7270
COA Handling Instructions

Neuroserpin Protein, Human (CHO) is a member of the serpin family of serine protease inhibitors, playing an important role in synaptic plasticity and memory formation in the hippocampus.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $70 In-stock
10 μg $120 In-stock
50 μg $270 In-stock
100 μg $460 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Neuroserpin Protein, Human (CHO) is a member of the serpin family of serine protease inhibitors, playing an important role in synaptic plasticity and memory formation in the hippocampus.

Background

Neuroserpin is a member of the serpin family of serine protease inhibitors predominantly expressed in the nervous system. Neuroserpin plays an important role in synaptic plasticity and memory formation in the hippocampus. Neuroserpin expression is particularly prominent at late stages of neuronal development in most regions of the central nervous system (CNS), whereas it is restricted to regions related to learning and memory in the adult brain[1].

Biological Activity

The ED50 determined by a cell proliferation assay using rat C6 cells. The ED50 for this effect is ≤ 2.218 μg/mL, corresponding to a specific activity of ≥ 450.857 units/mg.

  • The ED50 as determined by a cell proliferation assay using rat C6 cells. The ED50 for this effect is 2.218 μg/mL, corresponding to a specific activity is 450.857 units/mg.
Species

Human

Source

CHO

Tag

Tag Free

Accession

Q99574 (T17-L410)

Gene ID
Molecular Construction
N-term
Neuroserpin (T17-L410)
Accession # Q99574
C-term
Synonyms
rHuNeuroserpin; Peptidase inhibitor 12; Serpin I1; SERPINI1
AA Sequence

TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEG

Molecular Weight

40-45 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

< 0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

Neuroserpin Protein, Human (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Neuroserpin Protein, Human (CHO)
Cat. No.:
HY-P7270
Quantity:
MCE Japan Authorized Agent: