Neurotrimin Protein, Human (HEK293, His)

Neurotrimin Protein, a neural cell adhesion molecule, plays a crucial role in facilitating neural connections through its adhesive properties. As a member of the cell adhesion molecule family, Neurotrimin influences various aspects of neural function, including cell adhesion, communication, and potential contributions to neuronal development and synaptic plasticity, underscoring its significance as a molecular mediator within the nervous system. Neurotrimin Protein, Human (HEK293, His) is the recombinant human-derived Neurotrimin protein, expressed by HEK293 , with C-6*His labeled tag.

Neurotrimin, a neural cell adhesion molecule, serves as a crucial player in cellular interactions within the nervous system. As a member of the cell adhesion molecule family, Neurotrimin is implicated in facilitating neural connections through its adhesive properties. The protein's role encompasses various aspects of neural function, including cell adhesion, communication, and potentially influencing processes such as neuronal development and synaptic plasticity. Neurotrimin's involvement highlights its significance as a molecular mediator in the intricate network of interactions within the nervous system.

Human

HEK293

C-6*His

Q9P121-3 (G34-L316)

50863  [NCBI]

Partial

GDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVEISSDISINEGNNISLTCIATGRPEPTVTWRHISPKAVGFVSEDEYLEIQGITREQSGDYECSASNDVAAPVVRRVKVTVNYPPYISEAKGTGVPVGQKGTLQCEASAVPSAEFQWYKDDKRLIEGKKGVKVENRPFLSKLIFFNVSEHDYGNYTCVASNKLGHTNASIMLFGETVL

51-60 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.