NFKB1 Protein, Human (His)
Based on 1 Customer Validation
The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.
NFKB1 protein serves as a pivotal component of the pleiotropic transcription factor NF-kappa-B, found ubiquitously across various cell types. This transcription factor acts as a central mediator in signal transduction pathways associated with diverse biological processes, including inflammation, immunity, differentiation, cell growth, tumorigenesis, and apoptosis. NFKB1 participates in homo- or heterodimeric complexes, with the p65-p50 heterodimer being the most prevalent. These dimers selectively bind to kappa-B sites in target gene DNA, exhibiting distinct preferences and affinities. NF-kappa-B regulation involves intricate post-translational modifications, subcellular compartmentalization, and interactions with cofactors or corepressors. In an inactive state, NF-kappa-B complexes associate with NF-kappa-B inhibitor (I-kappa-B) family members in the cytoplasm. Activation ensues through phosphorylation and degradation of I-kappa-B, liberating active NF-kappa-B complexes for nuclear translocation. NFKB1 exhibits dual functions, contributing to cytoplasmic retention of NF-kappa-B proteins and generating the active p50 subunit through cotranslational processing. This processing, mediated by the proteasome, ensures the independent functionality of p50 and p105. The p50 subunit binds to kappa-B consensus sequences in the enhancer regions of genes involved in immune response and acute phase reactions. Additionally, NFKB1, in association with MAP3K8, represses MAP3K8-induced MAPK signaling, with active MAP3K8 released through proteasome-dependent degradation of NFKB1/p105.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P19838-2 (M1-G434)
-
Molecular Construction
-
N-term
-
6*His
-
NFKB1 (M1-G434)
Accession # P19838-2 -
C-term
-
-
Protein Length
Full Length of NFKB1 p50 subunit
-
Synonyms
NFKB1; KBF1; Nuclear Factor Kappa B Subunit 1; P105; Nuclear Factor Of Kappa Light Polypeptide Gene Enhancer In B-Cells 1; P50; Nuclear Factor NF-Kappa-B P105 Subunit; Nuclear Factor Kappa-B DNA Binding Subunit; DNA-Binding Factor KBF1; Nuclear Factor NF-
-
AA Sequence
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG
-
Molecular Weight
Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20 mM GSH, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)