NFKB1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

NFKB1 protein serves as a pivotal component of the pleiotropic transcription factor NF-kappa-B, found ubiquitously across various cell types. This transcription factor acts as a central mediator in signal transduction pathways associated with diverse biological processes, including inflammation, immunity, differentiation, cell growth, tumorigenesis, and apoptosis. NFKB1 participates in homo- or heterodimeric complexes, with the p65-p50 heterodimer being the most prevalent. These dimers selectively bind to kappa-B sites in target gene DNA, exhibiting distinct preferences and affinities. NF-kappa-B regulation involves intricate post-translational modifications, subcellular compartmentalization, and interactions with cofactors or corepressors. In an inactive state, NF-kappa-B complexes associate with NF-kappa-B inhibitor (I-kappa-B) family members in the cytoplasm. Activation ensues through phosphorylation and degradation of I-kappa-B, liberating active NF-kappa-B complexes for nuclear translocation. NFKB1 exhibits dual functions, contributing to cytoplasmic retention of NF-kappa-B proteins and generating the active p50 subunit through cotranslational processing. This processing, mediated by the proteasome, ensures the independent functionality of p50 and p105. The p50 subunit binds to kappa-B consensus sequences in the enhancer regions of genes involved in immune response and acute phase reactions. Additionally, NFKB1, in association with MAP3K8, represses MAP3K8-induced MAPK signaling, with active MAP3K8 released through proteasome-dependent degradation of NFKB1/p105.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • NFKB1 (M1-G434)
      Accession # P19838-2
    • C-term
  • Protein Length

    Full Length of NFKB1 p50 subunit

  • Synonyms

    NFKB1; KBF1; Nuclear Factor Kappa B Subunit 1; P105; Nuclear Factor Of Kappa Light Polypeptide Gene Enhancer In B-Cells 1; P50; Nuclear Factor NF-Kappa-B P105 Subunit; Nuclear Factor Kappa-B DNA Binding Subunit; DNA-Binding Factor KBF1; Nuclear Factor NF-

  • AA Sequence

    MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

  • Molecular Weight

    Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20 mM GSH, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00