NFKB1 Protein, Human (His)

The NFKB1 protein is a subunit of NF-kappa-B and regulates transcription in a variety of biological processes. It forms homodimeric or heterodimeric complexes with RELA/p65, RELB, and NFKB2/p52. NFKB1 Protein, Human (His) is the recombinant human-derived NFKB1 protein, expressed by E. coli , with N-6*His labeled tag.

NFKB1 protein serves as a pivotal component of the pleiotropic transcription factor NF-kappa-B, found ubiquitously across various cell types. This transcription factor acts as a central mediator in signal transduction pathways associated with diverse biological processes, including inflammation, immunity, differentiation, cell growth, tumorigenesis, and apoptosis. NFKB1 participates in homo- or heterodimeric complexes, with the p65-p50 heterodimer being the most prevalent. These dimers selectively bind to kappa-B sites in target gene DNA, exhibiting distinct preferences and affinities. NF-kappa-B regulation involves intricate post-translational modifications, subcellular compartmentalization, and interactions with cofactors or corepressors. In an inactive state, NF-kappa-B complexes associate with NF-kappa-B inhibitor (I-kappa-B) family members in the cytoplasm. Activation ensues through phosphorylation and degradation of I-kappa-B, liberating active NF-kappa-B complexes for nuclear translocation. NFKB1 exhibits dual functions, contributing to cytoplasmic retention of NF-kappa-B proteins and generating the active p50 subunit through cotranslational processing. This processing, mediated by the proteasome, ensures the independent functionality of p50 and p105. The p50 subunit binds to kappa-B consensus sequences in the enhancer regions of genes involved in immune response and acute phase reactions. Additionally, NFKB1, in association with MAP3K8, represses MAP3K8-induced MAPK signaling, with active MAP3K8 released through proteasome-dependent degradation of NFKB1/p105.

Human

E. coli

N-6*His

P19838-2 (M1-G434)

4790  [NCBI]

Full Length of NFKB1

MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTADGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG

Approximately 45-55 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 20 mM GSH, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.