Copy Link Print Information

Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

Niemann-Pick C2/NPC2 protein is an important member of the NPC2 family and plays an important role in lipid metabolism and transport, helping to regulate intracellular cholesterol homeostasis and lipid transport.Its involvement in cellular processes highlights its importance in maintaining lipid homeostasis.Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) is the recombinant rat-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)
  • Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Niemann-Pick C2/NPC2 protein is an important member of the NPC2 family and plays an important role in lipid metabolism and transport, helping to regulate intracellular cholesterol homeostasis and lipid transport.Its involvement in cellular processes highlights its importance in maintaining lipid homeostasis.Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) is the recombinant rat-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Niemann-Pick C2/NPC2 Protein is a crucial member of the NPC2 family, playing a significant role in lipid metabolism and transport. As part of this family, NPC2 contributes to the regulation of cholesterol homeostasis and lipid trafficking within cells. Its involvement in cellular processes highlights its importance in maintaining cellular lipid balance. The protein's membership in the NPC2 family suggests shared functional characteristics within this protein family, potentially influencing lipid-related pathways and cellular functions. The study of NPC2 provides insights into the broader understanding of lipid transport and metabolism, emphasizing its relevance in cellular homeostasis and potential implications for disorders related to lipid dysregulation.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q8CHN5 (E20-G149)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • NPC2 (E20-G149)
      Accession # Q8CHN5
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    NPC2; Epididymal Protein 1; NPC Intracellular Cholesterol Transporter 2; NP-C2; HE1; Epididymis Secretory Sperm Binding Protein; EDDM1; Tissue-Specific Secretory Protein; Niemann-Pick Disease Type C2 Protein; Niemann-Pick Disease, Type C2; Human Epididymi

  • AA Sequence

    EPLHFKDCGSKVGVIKEVNVSPCPTQPCQLHKGQSYSVNVTFTSGTQSQNSTALVHGILAGVPVYFPIPEPDGCKCGINCPIQKDKVYSYLNKLPVKSEYPSLKLVVEWKLQDDKKDNLFCWEIPVEIKG

  • Molecular Weight

    Approximately 19-22 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)
  • Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) Product Image