1. Recombinant Proteins
  2. Others
  3. Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)

Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)

Cat. No.: HY-P74692
Handling Instructions Technical Support

Niemann-Pick C2/NPC2 protein is an important member of the NPC2 family and plays an important role in lipid metabolism and transport, helping to regulate intracellular cholesterol homeostasis and lipid transport.Its involvement in cellular processes highlights its importance in maintaining lipid homeostasis.Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) is the recombinant rat-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Niemann-Pick C2/NPC2 protein is an important member of the NPC2 family and plays an important role in lipid metabolism and transport, helping to regulate intracellular cholesterol homeostasis and lipid transport.Its involvement in cellular processes highlights its importance in maintaining lipid homeostasis.Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) is the recombinant rat-derived Niemann Pick C2/NPC2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The Niemann-Pick C2/NPC2 Protein is a crucial member of the NPC2 family, playing a significant role in lipid metabolism and transport. As part of this family, NPC2 contributes to the regulation of cholesterol homeostasis and lipid trafficking within cells. Its involvement in cellular processes highlights its importance in maintaining cellular lipid balance. The protein's membership in the NPC2 family suggests shared functional characteristics within this protein family, potentially influencing lipid-related pathways and cellular functions. The study of NPC2 provides insights into the broader understanding of lipid transport and metabolism, emphasizing its relevance in cellular homeostasis and potential implications for disorders related to lipid dysregulation.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

Q8CHN5 (E20-G149)

Gene ID

/

Molecular Construction
N-term
NPC2 (E20-G149)
Accession # Q8CHN5
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
NPC intracellular cholesterol transporter 2; Niemann-Pick disease type C2 protein; HE1
AA Sequence

EPLHFKDCGSKVGVIKEVNVSPCPTQPCQLHKGQSYSVNVTFTSGTQSQNSTALVHGILAGVPVYFPIPEPDGCKCGINCPIQKDKVYSYLNKLPVKSEYPSLKLVVEWKLQDDKKDNLFCWEIPVEIKG

Molecular Weight

Approximately 19-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Niemann Pick C2/NPC2 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Niemann Pick C2/NPC2 Protein, Rat (HEK293, His)
Cat. No.:
HY-P74692
Quantity:
MCE Japan Authorized Agent: