1. Recombinant Proteins
  2. Others
  3. Ninjurin-1 Protein, Rat (HEK293, Fc)

Ninjurin-1 Protein, Rat (HEK293, Fc)

Cat. No.: HY-P77104
SDS COA Handling Instructions

The Ninjurin-1 protein is a key player in programmed cell death, driving plasma membrane rupture in the necroptosis and pyroptosis pathways.Ninjurin-1 oligomerizes downstream of gasdermin or MLKL activation, inducing cell lysis and releasing inflammatory DAMPs.Ninjurin-1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ninjurin-1 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $57 In-stock
10 μg $96 In-stock
50 μg $270 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Ninjurin-1 protein is a key player in programmed cell death, driving plasma membrane rupture in the necroptosis and pyroptosis pathways.Ninjurin-1 oligomerizes downstream of gasdermin or MLKL activation, inducing cell lysis and releasing inflammatory DAMPs.Ninjurin-1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ninjurin-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Ninjurin-1 Protein serves as a pivotal effector in programmed cell death, orchestrating plasma membrane rupture during necroptotic and pyroptotic pathways. Downstream of Gasdermin or MLKL activation, Ninjurin-1 oligomerizes, introducing hydrophilic faces into the membrane and inducing cytolysis, releasing damage-associated molecular patterns (DAMPs) that fuel the inflammatory response. Additionally, it regulates Toll-like receptor 4 signaling triggered by lipopolysaccharide during systemic inflammation by directly binding LPS. In inflammation, Ninjurin-1 promotes leukocyte migration and transendothelial migration of macrophages, facilitating monocyte recruitment to inflammatory sites and mitigating atherosclerosis. Beyond its role in inflammation, Ninjurin-1 acts as a homophilic transmembrane adhesion molecule, contributing to processes such as axonal growth, angiogenesis, and osteoclast development. Its secreted form exhibits chemotactic activity, enhancing monocyte recruitment and acting as an anti-inflammatory mediator in atherosclerosis.

Species

Rat

Source

HEK293

Tag

N-hFc

Accession

P70617 (M1-P79)

Gene ID
Molecular Construction
N-term
hFc
Ninjurin-1 (M1-P79)
Accession # P70617
C-term
Synonyms
Nerve injury-induced protein 1; NIN1; NINJ1
AA Sequence

MDPGTEEYELNGDLRPGSPGSPDASPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNEFAFFVP

Molecular Weight

Approximately 50 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS, pH 7.4 . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Ninjurin-1 Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Ninjurin-1 Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P77104
Quantity:
MCE Japan Authorized Agent: