Ninjurin-1 Protein, Rat (HEK293, Fc)

The Ninjurin-1 protein is a key player in programmed cell death, driving plasma membrane rupture in the necroptosis and pyroptosis pathways.Ninjurin-1 oligomerizes downstream of gasdermin or MLKL activation, inducing cell lysis and releasing inflammatory DAMPs.Ninjurin-1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived Ninjurin-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Ninjurin-1 Protein serves as a pivotal effector in programmed cell death, orchestrating plasma membrane rupture during necroptotic and pyroptotic pathways. Downstream of Gasdermin or MLKL activation, Ninjurin-1 oligomerizes, introducing hydrophilic faces into the membrane and inducing cytolysis, releasing damage-associated molecular patterns (DAMPs) that fuel the inflammatory response. Additionally, it regulates Toll-like receptor 4 signaling triggered by lipopolysaccharide during systemic inflammation by directly binding LPS. In inflammation, Ninjurin-1 promotes leukocyte migration and transendothelial migration of macrophages, facilitating monocyte recruitment to inflammatory sites and mitigating atherosclerosis. Beyond its role in inflammation, Ninjurin-1 acts as a homophilic transmembrane adhesion molecule, contributing to processes such as axonal growth, angiogenesis, and osteoclast development. Its secreted form exhibits chemotactic activity, enhancing monocyte recruitment and acting as an anti-inflammatory mediator in atherosclerosis.

Rat

HEK293

N-hFc

P70617 (M1-P79)

25338  [NCBI]

Partial

MDPGTEEYELNGDLRPGSPGSPDASPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNEFAFFVP

Approximately 50 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.