1. Recombinant Proteins
  2. Receptor Proteins
  3. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P78830
Handling Instructions Technical Support

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
25 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function[1][2][3]. NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

NKp46 is a ~46 kDa type 1 transmembrane glycoprotein characterized by a 30 a.a. intracellular tail, 20 a.a. transmembrane domain, and two extracellular Ig-like domains that are contacted through a 25 a.a short peptide. NKp46 is a novel triggering receptor that is involved in natural cytotoxicity[1].
NKp46 is uniquely expressed on all NK cell subsets and has been suggested as a possible target for NK cell ablation and as a pan NK cell marker. Distinct among the NCRs, NKp46 (NCR1) is evolutionary conserved between mice and humans. knock-down of NKp46 in primary human NK cells decreased recruitment of F-actin to the synapse[1].
NKp46 contributes to clearance of Streptococcus pneumoniae by interacting with infected alveolar macrophages. Targeting of NK cells using an NKp46 antibody can attenuate type 1 diabetes progression in mice. NKp46 also regulates graft-versus-host disease and allergic response. Following the initiation of an NK-target cell interaction, NKp46 clusters at the cell membrane, specifically at the immune synapse. At the immune synapse, NKp46 mediates cytoskeletal rearrangement and cellular polarization[1].
Cross-linking of NKp46 led to a strong NK cell activation resulting in induction of Ca2+ mobilization, cytotoxicity and lymphokine release[2].
The natural cytotoxicity receptor (NCR) family that includes NKp30, NKp44, and NKp46 is the biggest family of activating human NK-cell receptors. NKp46 is the only NCR member that has a mouse orthologue, named Ncr1. The first ligand identified for NKp46/NCR1 receptors is the hemagglutinin (HA) protein of influenza virus[3].

Biological Activity

Immobilized Biotinylated Human NKp46 Fc-Avi at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Anti-NKP46 Antibody Human IgG1 with a linear range of 0.5-4 ng/mL.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

AAH64806 (Q22-N254)

Gene ID
Conjugation

Biotin

Synonyms
NCR1; LY94; CD335; NK-p46; hNKp46
AA Sequence

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

분자량

60-65 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of Tris with Glycine, Arginine and NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
NKp46/NCR1 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P78830
수량:
MCE Japan Authorized Agent: