NKp46/NCR1 Protein, Human (HEK293, Fc)

NKp46/NCR1 Protein is a major NK cell-activating receptor that is involved in the elimination of target cells and recognizing a wide range of tumors, viruses, and bacteria. NKp46 forms microclusters structures at the immune synapse between NK cells and target cells. Over-expression of human NKp46 is correlated with increased accumulation of F-actin mesh at the immune synapse. NKp46 signaling directly regulates the NK lytic immune synapse from early formation to late function^[1][2][3]. NKp46/NCR1 Protein, Human (HEK293, Fc) is the recombinant human-derived NKp46/NCR1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of NKp46/NCR1 Protein, Human (HEK293, Fc) is 233 a.a., with molecular weight of ~66.0 kDa.

NKp46 is a ~46 kDa type 1 transmembrane glycoprotein characterized by a 30 a.a. intracellular tail, 20 a.a. transmembrane domain, and two extracellular Ig-like domains that are contacted through a 25 a.a short peptide. NKp46 is a novel triggering receptor that is involved in natural cytotoxicity^[1].
NKp46 is uniquely expressed on all NK cell subsets and has been suggested as a possible target for NK cell ablation and as a pan NK cell marker. Distinct among the NCRs, NKp46 (NCR1) is evolutionary conserved between mice and humans. knock-down of NKp46 in primary human NK cells decreased recruitment of F-actin to the synapse^[1].
NKp46 contributes to clearance of Streptococcus pneumoniae by interacting with infected alveolar macrophages. Targeting of NK cells using an NKp46 antibody can attenuate type 1 diabetes progression in mice. NKp46 also regulates graft-versus-host disease and allergic response. Following the initiation of an NK-target cell interaction, NKp46 clusters at the cell membrane, specifically at the immune synapse. At the immune synapse, NKp46 mediates cytoskeletal rearrangement and cellular polarization^[1].
Cross-linking of NKp46 led to a strong NK cell activation resulting in induction of Ca²⁺ mobilization, cytotoxicity and lymphokine release^[2].
The natural cytotoxicity receptor (NCR) family that includes NKp30, NKp44, and NKp46 is the biggest family of activating human NK-cell receptors. NKp46 is the only NCR member that has a mouse orthologue, named Ncr1. The first ligand identified for NKp46/NCR1 receptors is the hemagglutinin (HA) protein of influenza virus^[3].

Human

HEK293

C-hFc

O76036-6/AAH64806 (Q22-D254)

9437  [NCBI]

QQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQLHFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEMYDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQN

Approximately 66.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.