NKp80/KLRF1 Protein, Human (HEK293, His)

The NKp80/KLRF1 protein is critically involved in NK-mediated PHA-induced cytolysis of lymphoblasts, emphasizing its importance in immune responses against activated cells. Its involvement suggests a role in identifying and targeting specific cellular targets for elimination. NKp80/KLRF1 Protein, Human (HEK293, His) is the recombinant human-derived NKp80/KLRF1 protein, expressed by HEK293 , with N-6*His labeled tag.

The NKp80/KLRF1 Protein plays a crucial role in the natural killer (NK)-mediated cytolysis of PHA-induced lymphoblasts, underscoring its significance in the immune response against aberrant or activated cells. This involvement suggests NKp80/KLRF1's function in recognizing and targeting specific cellular targets for elimination through NK-mediated cytolysis. Additionally, the protein exists as a homodimer, emphasizing its structural configuration and potential implications for its functional activities in the context of immune surveillance and the elimination of target cells by NK cells.

Measured by the ability of the immobilized protein to support the adhesion of U937 cells. When 5 x 10^4 cells/well are added to Recombinant Human KLRF1 coated plates (5 µg/mL, 100 µL/well), > 40% cells will adhere after 1 hour incubation.

Human

HEK293

N-6*His

Q9NZS2-1 (V66-Y231)

51348  [NCBI]

Partial

VLLKCQKGSCSNATQYEDTGDLKVNNGTRRNISNKDLCASRSADQTVLCQSEWLKYQGKCYWFSNEMKSWSDSYVYCLERKSHLLIIHDQLEMAFIQKNLRQLNYVWIGLNFTSLKMTWTWVDGSPIDSKIFFIKGPAKENSCAAIKESKIFSETCSSVFKWICQY

Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.