NME1/NDPKA Protein, Human (His)

The NME1/NDPKA protein plays a crucial role in the synthesis of nucleoside triphosphates and exhibits multiple activities, including nucleoside diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease functions. NME1/NDPKA Protein, Human (His) is the recombinant human-derived NME1/NDPKA protein, expressed by E. coli , with N-6*His labeled tag. The total length of NME1/NDPKA Protein, Human (His) is 152 a.a., with molecular weight of ~20.0 kDa.

NME1/NDPKA Protein plays a major role in synthesizing nucleoside triphosphates, excluding ATP. It utilizes a ping-pong mechanism, transferring the ATP gamma phosphate to the NDP beta phosphate via a phosphorylated active-site intermediate. The protein exhibits diverse activities, including nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl/farnesyl pyrophosphate kinase, histidine protein kinase, and 3'-5' exonuclease. NME1 is crucial for cell proliferation, differentiation, development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. It is essential for neural development, impacting neural patterning and cell fate determination. In GZMA-mediated cell death, NME1 collaborates with TREX1, nicking one DNA strand and enhancing DNA damage to prevent rapid repair and reannealing.

Human

E. coli

N-6*His

P15531 (M1-E152)

4830  [NCBI]

MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

Approximately 20.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.