Copy Link Print Information

NME1/NDPKA Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The NME1/NDPKA protein plays a crucial role in the synthesis of nucleoside triphosphates and exhibits multiple activities, including nucleoside diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease functions. NME1/NDPKA Protein, Human (His) is the recombinant human-derived NME1/NDPKA protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • NME1/NDPKA Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The NME1/NDPKA protein plays a crucial role in the synthesis of nucleoside triphosphates and exhibits multiple activities, including nucleoside diphosphate kinase, serine/threonine-specific protein kinase, geranyl and farnesyl pyrophosphate kinase, histidine protein kinase and 3'-5' exonuclease functions. NME1/NDPKA Protein, Human (His) is the recombinant human-derived NME1/NDPKA protein, expressed by E. coli , with N-6*His labeled tag.

Background

NME1/NDPKA Protein plays a major role in synthesizing nucleoside triphosphates, excluding ATP. It utilizes a ping-pong mechanism, transferring the ATP gamma phosphate to the NDP beta phosphate via a phosphorylated active-site intermediate. The protein exhibits diverse activities, including nucleoside-diphosphate kinase, serine/threonine-specific protein kinase, geranyl/farnesyl pyrophosphate kinase, histidine protein kinase, and 3'-5' exonuclease. NME1 is crucial for cell proliferation, differentiation, development, signal transduction, G protein-coupled receptor endocytosis, and gene expression. It is essential for neural development, impacting neural patterning and cell fate determination. In GZMA-mediated cell death, NME1 collaborates with TREX1, nicking one DNA strand and enhancing DNA damage to prevent rapid repair and reannealing.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P15531-1 (M1-E152)

  • Gene ID
    4830  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • NME1 (M1-E152)
      Accession # P15531-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    NME1; Histidine Protein Kinase NME1; NME/NM23 Nucleoside Diphosphate Kinase 1; NDP Kinase A; NM23-H1; NDPK A; NDPKA; GAAD; NM23; NDK1; Nucleoside Diphosphate Kinase A; Epididymis Secretory Sperm Binding Protein; Non-Metastatic Cells 1, Protein (NM23A) Exp

  • AA Sequence

    MANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYTSCAQNWIYE

  • Predicted Molecular Mass

    19.3 kDa

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 1 mM DTT, 10% glycerol, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • NME1/NDPKA Protein, Human (His) Product Image
    1/16
  • NME1/NDPKA Protein, Human (His) Product Image