1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Noggin Protein, Mouse (HEK293)

Noggin Protein, Mouse (HEK293)

Cat. No.: HY-P700286
COA Handling Instructions

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites. By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6. Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free. The total length of Noggin Protein, Mouse (HEK293) is 205 a.a., with molecular weight of 27-31 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $76 In-stock
10 μg $129 In-stock
50 μg $360 In-stock
100 μg $580 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites. By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6. Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free. The total length of Noggin Protein, Mouse (HEK293) is 205 a.a., with molecular weight of 27-31 kDa.

Background

Noggin is a vital protein involved in cartilage morphogenesis and joint formation, playing a crucial role in inhibiting bone morphogenetic proteins (BMP) signaling essential for the growth and patterning of the neural tube and somite. Acting as an inhibitor of BMP, Noggin is implicated in the regulation of chondrocyte differentiation through its interaction with growth and differentiation factor 5 (GDF5) and likely GDF6. Existing as a homodimer, Noggin directly interacts with GDF5, leading to the inhibition of chondrocyte differentiation. These multifaceted functions underscore the importance of Noggin in embryonic development, particularly in the intricate processes of skeletal and neural tissue formation, and highlight its role as a key modulator of BMP signaling pathways (

Biological Activity

Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The EC50 is 4.6 ng/mL, corresponding to a specific activity of 217391.3043 units/mg.

  • Measured by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 is <4.6 ng/mL, corresponding to a specific activity of >2.2 × 105 units/mg.
Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P97466 (Q28-C232)

Gene ID

18121  [NCBI]

Molecular Construction
N-term
Noggin (Q28-C232)
Accession # P97466
C-term
Synonyms
NOG; Noggin; SYM1; SYNS1; SYNS1A
AA Sequence

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Weight

Approximately 27-31 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Noggin Protein, Mouse (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Noggin Protein, Mouse (HEK293)
Cat. No.:
HY-P700286
Quantity:
MCE Japan Authorized Agent: