NOX1 Protein, Human (Cell-Free, His)

The NOX1 protein contains two isoforms with different functions. NOH-1S acts as a voltage-gated proton channel, manages H(+) currents in quiescent phagocytes and tissues, affects cellular pH, and is inhibited by zinc. NOX1 Protein, Human (Cell-Free, His) is the recombinant human-derived NOX1 protein, expressed by E. coli Cell-free , with N-10*His labeled tag. The total length of NOX1 Protein, Human (Cell-Free, His) is 564 a.a., with molecular weight of 67.7 kDa.

NOX1 protein encompasses two distinct isoforms with contrasting functions. NOH-1S operates as a voltage-gated proton channel, orchestrating H(+) currents primarily in quiescent phagocytes and various tissues. This isoform actively contributes to the regulation of cellular pH and is susceptible to inhibition by zinc. On the other hand, NOH-1L functions as a pyridine nucleotide-dependent oxidoreductase, exhibiting the capability to generate superoxide while potentially facilitating the conduction of H(+) ions as part of its electron transport mechanism. It's noteworthy that NOH-1S lacks an electron transport chain, differentiating its functional characteristics from NOH-1L.

Human

E. coli Cell-free

N-10*His

Q9Y5S8 (M1-F564)

27035

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

67.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.