NOX1 Protein, Human (Cell-Free, His)
Based on 1 Customer Validation
The NOX1 protein contains two isoforms with different functions. NOH-1S acts as a voltage-gated proton channel, manages H(+) currents in quiescent phagocytes and tissues, affects cellular pH, and is inhibited by zinc. NOX1 Protein, Human (Cell-Free, His) is the recombinant human-derived NOX1 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
- Species: Human
- Source: E. coli Cell-free
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The NOX1 protein contains two isoforms with different functions. NOH-1S acts as a voltage-gated proton channel, manages H(+) currents in quiescent phagocytes and tissues, affects cellular pH, and is inhibited by zinc. NOX1 Protein, Human (Cell-Free, His) is the recombinant human-derived NOX1 protein, expressed by E. coli Cell-free, with N-10*His labeled tag.
NOX1 protein encompasses two distinct isoforms with contrasting functions. NOH-1S operates as a voltage-gated proton channel, orchestrating H(+) currents primarily in quiescent phagocytes and various tissues. This isoform actively contributes to the regulation of cellular pH and is susceptible to inhibition by zinc. On the other hand, NOH-1L functions as a pyridine nucleotide-dependent oxidoreductase, exhibiting the capability to generate superoxide while potentially facilitating the conduction of H(+) ions as part of its electron transport mechanism. It's noteworthy that NOH-1S lacks an electron transport chain, differentiating its functional characteristics from NOH-1L.
Technical Parameters
-
Species Human
-
Source E. coli Cell-free
-
Tag N-10*His
-
Accession
Q9Y5S8 (M1-F564)
-
Gene ID27035
-
Molecular Construction
-
N-term
-
10*His
-
NOX1 (M1-F564)
Accession # Q9Y5S8 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NADPH oxidase 1; EC:1.6.3.-; NOX-1; Mitogenic oxidase 1 (MOX-1); NADH/NADPH mitogenic oxidase subunit P65-MOX; NOH-1; NOX1; MOX1; NOH1
-
AA Sequence
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYKFQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF
-
Predicted Molecular Mass
67.7 kDa
-
Molecular Weight
Approximately 64 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.15 M NaCl, 0.05% Brij78, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add 5-50% of glycerol (final concentration). Our default final concentration of glycerol is 50%. Customers could use it as reference.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
