NPPB Protein, Human (76a.a, Flag-His)

NPPB proteins are members of the natriuretic peptide family and are key regulators of cardiovascular homeostasis. As a hormone, NPPB is produced and released primarily by ventricular myocytes in response to increases in pressure and volume. NPPB Protein, Human (76a.a, Flag-His) is the recombinant human-derived NPPB protein, expressed by E. coli , with N-6*His, N-Flag labeled tag.

TRIM5 protein serves as a capsid-specific restriction factor, impeding the infection of non-host-adapted retroviruses by blocking viral replication early in the viral life cycle, specifically after viral entry but before reverse transcription. Beyond its role as a capsid-specific restriction factor, TRIM5 also functions as a pattern recognition receptor, activating innate immune signaling in response to the retroviral capsid lattice. Upon binding to the viral capsid, TRIM5 triggers its E3 ubiquitin ligase activity, collaborating with the UBE2V1-UBE2N complex to generate 'Lys-63'-linked polyubiquitin chains. This ubiquitination process leads to the autophosphorylation of the MAP3K7/TAK1 complex, resulting in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes, ultimately initiating an innate immune response in the infected cell. TRIM5's restrictive capabilities extend to various retroviruses, including N-tropic murine leukemia virus (N-MLV), equine infectious anemia virus (EIAV), simian immunodeficiency virus of macaques (SIVmac), feline immunodeficiency virus (FIV), and bovine immunodeficiency virus (BIV). Additionally, TRIM5 plays a crucial role in regulating autophagy by activating the autophagy regulator BECN1, causing its dissociation from inhibitors BCL2 and TAB2. Furthermore, TRIM5 acts as a selective autophagy receptor, recognizing and targeting HIV-1 capsid protein p24 for autophagic degradation.

Human

E. coli

N-6*His;N-Flag

P16860 (H27-R102)

4879  [NCBI]

Partial

HPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.

• [1]. /biology-dictionary/thp-1-cell.html  [Content Brief]