1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Neuregulins
  5. Neuregulin-1 (NRG1)
  6. NRG1-beta 2 Protein, Human

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HRG1-β1 belongs to a family of structurally-related polypeptide growth factors derived from alternatively spliced genes, induces Fn14 expression in MCF7 cells. NRG1-beta 2 Protein, Human is the recombinant human-derived NRG1-beta 2 protein, expressed by E. coli , with tag free.

Background

HRG1-β1 activates HER2/HER3 signaling and up-regulate Fn14 gene expression in parental MCF7 cells. HRG1-β1-mediated Fn14 up-regulation in MCF7/HER2-18 cells is required for maximal MMP-9 production.

Biological Activity

The ED50 is <50 ng/mL as measured by serum free human MCF-7 cells, corresponding to a specific activity of > 2.0×104 units/mg.

  • Measured in a serum-free cell proliferation assay using MCF-7 human breast cancer cells. The ED50 for this effect is 33.72 ng/mL. corresponding to a specific activity is 2.96×104 units/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q02297-7 (S177-Q237)/E5RIG8 (S23-Q83)

Gene ID
Molecular Construction
N-term
NRG1-beta 2 (S177-Q237)
Accession # Q02297-7
C-term
Protein Length

Partial

Synonyms
NRG-1 EGF-like domain beta 2; Beta2; Neuregulin-1 beta 2
AA Sequence

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ

Predicted Molecular Mass
7 kDa
Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

NRG1-beta 2 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NRG1-beta 2 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NRG1-beta 2 Protein, Human
Cat. No.:
HY-P73304
Quantity:
MCE Japan Authorized Agent: