NRN1L Protein, Human (HEK293, His)
NRN1L Protein is encoded by nrn1l gene in extracellular and enhances both neurite growth and neuronal survival. NRN1L protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer. NRN1L Protein belongs to the neuritin (Nrn1) family. NRN1 is involved in neural development, synaptic plasticity, and synapse maturation. NRN1L Protein, Human (HEK293, His) is the recombinant human-derived NRN1L protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NRN1L Protein is encoded by nrn1l gene in extracellular and enhances both neurite growth and neuronal survival. NRN1L protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer. NRN1L Protein belongs to the neuritin (Nrn1) family. NRN1 is involved in neural development, synaptic plasticity, and synapse maturation[1][2]. NRN1L Protein, Human (HEK293, His) is the recombinant human-derived NRN1L protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Neuritin (Nrn1) is a glycophosphatidylinositol-linked protein. Nrn1 is expressed in various human tissues including the nervous system, specifically in the lipid rafts of cell membranes. Nrn1 promotes neurite outgrowth, dendritic growth, neuronal migration, and synapse maturation in neurons of the visual cortex; it also regulates synaptic plasticity, apoptosis of peripheral neurons and spinal axon regeneration and promotes recovery following cerebral ischemia[2].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q496H8 (A36-A139)
-
Molecular Construction
-
N-term
-
NRN1L (A36-A139)
Accession # Q496H8 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NRN1L; UNQ2446; Neuritin 1 Like; Neuritin-Like Protein; MRCC2446; Cpg15-2
-
AA Sequence
AAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA
-
Predicted Molecular Mass
12.3 kDa
-
Molecular Weight
Approximately 14 kDa & 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
