NRN1L Protein, Human (HEK293, His)

NRN1L Protein is encoded by nrn1l gene in extracellular and enhances both neurite growth and neuronal survival. NRN1L protein is found both as a GPI anchored membrane-bound form and as a secreted form. This activity-related ligand functions as a homodimer or heterodimer. NRN1L Protein belongs to the neuritin (Nrn1) family. NRN1 is involved in neural development, synaptic plasticity, and synapse maturation^[1][2]. NRN1L Protein, Human (HEK293, His) is the recombinant human-derived NRN1L protein, expressed by HEK293, with C-6*His labeled tag. The total length of NRN1L Protein, Human (HEK293, His) is 104 a.a., with molecular weight of 14 & 16 kDa, respectively.

Neuritin (Nrn1) is a glycophosphatidylinositol-linked protein. Nrn1 is expressed in various human tissues including the nervous system, specifically in the lipid rafts of cell membranes. Nrn1 promotes neurite outgrowth, dendritic growth, neuronal migration, and synapse maturation in neurons of the visual cortex; it also regulates synaptic plasticity, apoptosis of peripheral neurons and spinal axon regeneration and promotes recovery following cerebral ischemia^[2].

Human

HEK293

C-6*His

Q496H8 (A36-A139)

123904  [NCBI]

AAGPNRCDTIYQGFAECLIRLGDSMGRGGELETICRSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATA

14&16 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.