Nucleobindin-2 Protein, Human

Nucleobindin-2 protein is a calcium-binding molecule that may contribute to calcium homeostasis and act as a non-receptor guanine nucleotide exchange factor. Its interaction with the guanine nucleotide-binding protein (G protein) α subunit GNAI3 suggests its role in activating the G protein signaling pathway. Nucleobindin-2 Protein, Human is the recombinant human-derived Nucleobindin-2 protein, expressed by E. coli , with tag free. The total length of Nucleobindin-2 Protein, Human is 82 a.a., with molecular weight of ~10.0 kDa.

Nucleobindin-2 is a calcium-binding protein implicated in calcium homeostasis and serves as a non-receptor guanine nucleotide exchange factor, specifically interacting with and activating the guanine nucleotide-binding protein (G-protein) alpha subunit GNAI3. Beyond its role in calcium dynamics, Nucleobindin-2 functions as an anorexigenic peptide, demonstrating significance in hypothalamic pathways that regulate food intake and energy homeostasis, operating in a leptin-independent manner. Additionally, this protein is suggested to have potential hypertensive effects, modulating blood pressure by directly impacting peripheral arterial resistance. It has to highlight Nucleobindin-2's diverse roles in cellular processes, spanning calcium regulation, appetite control, and potential contributions to cardiovascular physiology.

Human

E. coli

Tag Free

P80303 (V25-L106)

4925  [NCBI]

VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

Approximately 10.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Sodium Phosphate, pH 6.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.