Copy Link Print Information

Nucleobindin-2 Protein, Human

Customer Review

Based on 1 Customer Validation

Nucleobindin-2 protein is a calcium-binding molecule that may contribute to calcium homeostasis and act as a non-receptor guanine nucleotide exchange factor. Its interaction with the guanine nucleotide-binding protein (G protein) α subunit GNAI3 suggests its role in activating the G protein signaling pathway. Nucleobindin-2 Protein, Human is the recombinant human-derived Nucleobindin-2 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Nucleobindin-2 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Nucleobindin-2 protein is a calcium-binding molecule that may contribute to calcium homeostasis and act as a non-receptor guanine nucleotide exchange factor. Its interaction with the guanine nucleotide-binding protein (G protein) α subunit GNAI3 suggests its role in activating the G protein signaling pathway. Nucleobindin-2 Protein, Human is the recombinant human-derived Nucleobindin-2 protein, expressed by E. coli , with tag free.

Background

Nucleobindin-2 is a calcium-binding protein implicated in calcium homeostasis and serves as a non-receptor guanine nucleotide exchange factor, specifically interacting with and activating the guanine nucleotide-binding protein (G-protein) alpha subunit GNAI3. Beyond its role in calcium dynamics, Nucleobindin-2 functions as an anorexigenic peptide, demonstrating significance in hypothalamic pathways that regulate food intake and energy homeostasis, operating in a leptin-independent manner. Additionally, this protein is suggested to have potential hypertensive effects, modulating blood pressure by directly impacting peripheral arterial resistance. It has to highlight Nucleobindin-2's diverse roles in cellular processes, spanning calcium regulation, appetite control, and potential contributions to cardiovascular physiology.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    P80303-1 (V25-L106)

  • Gene ID
    4925  [NCBI]
  • Molecular Construction
    • N-term
    • Nucleobindin-2 (V25-L106)
      Accession # P80303-1
    • C-term
  • Protein Length

    Full Length of Nesfatin-1 Chain

  • Synonyms

    NUCB2; Nucleobindin-2; Nucleobindin 2; Prepronesfatin; NEFA; Nesfatin 1; Novel DNA Binding/EF-Hand/Leucine Zipper Protein; Nucleobinding 2; Epididymis Secretory Protein Li 109; HEL-S-109; Gastric Cancer Antigen Zg4; Nesfatin; DNA-Binding Protein NEFA

  • AA Sequence

    VPIDIDKTKVQNIHPVESAKIEPPDTGLYYDEYLKQVIDVLETDKHFREKLQKADIEEIKSGRLSKELDLVSHHVRTKLDEL

  • Predicted Molecular Mass

    9.6 kDa

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Sodium pH osphate, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Nucleobindin-2 Protein, Human Product Image
    1/16
  • Nucleobindin-2 Protein, Human Product Image