NXPH1 Protein, Human (HEK293, His)

The NXPH1 protein resembles a neuropeptide and may affect cell signaling by binding to alpha-neurotoxins and other potential receptors. Although the specific mechanisms and downstream effects remain unclear, the neuropeptide-like characteristics of NXPH1 suggest that it plays a role in regulating cell signaling pathways. NXPH1 Protein, Human (HEK293, His) is the recombinant human-derived NXPH1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NXPH1 Protein, Human (HEK293, His) is 250 a.a., with molecular weight of 45-58 kDa.

The NXPH1 protein emerges as a potential signaling molecule resembling neuropeptides, likely exerting its actions through binding to alpha-neurexins and possibly other receptors. The precise mechanisms and specific downstream effects initiated by NXPH1 are yet to be fully elucidated, but its resemblance to neuropeptides suggests a potential role in modulating cellular signaling pathways. The interaction with alpha-neurexins and potentially other receptors implies a complex network of molecular communication, hinting at the versatility of NXPH1 in mediating cellular responses. The unique characteristics of NXPH1 make it a subject of interest for further exploration to uncover its specific contributions to the intricate landscape of neuropeptide-like signaling within biological systems.

Human

HEK293

C-6*His

P58417 (A22-G271)

30010  [NCBI]

ANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

45-58 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.