OSCAR Protein, Human (HEK293, Fc)

OSCAR Protein, a key orchestrator in bone biology, crucially regulates osteoclastogenesis, influencing osteoclast differentiation, formation, and maturation. Focused on bones, OSCAR plays a pivotal role in maintaining skeletal homeostasis and structural integrity, contributing to the dynamic equilibrium of bone remodeling. OSCAR Protein, Human (HEK293, Fc) is the recombinant human-derived OSCAR protein, expressed by HEK293 , with C-hFc labeled tag.

OSCAR, a key orchestrator in bone biology, emerges as a crucial regulator of osteoclastogenesis, wielding significant influence in the intricate process of osteoclast differentiation. With a bone-specific focus, OSCAR exerts its regulatory prowess to fine-tune the mechanisms governing the formation and maturation of osteoclasts. Through its pivotal role in osteoclastogenesis, OSCAR contributes to the dynamic equilibrium of bone remodeling, playing a crucial part in maintaining skeletal homeostasis and structural integrity.

Human

HEK293

C-hFc

Q8IYS5-2 (D19-N229)

126014  [NCBI]

Partial

DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGN

Approximately 60-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.