p53 Protein, Rat (His)

The p53 protein acts as a tumor suppressor, regulating the cell cycle and inducing growth arrest or apoptosis. It activates genes that inhibit cell division and triggers apoptosis by controlling the expression of various proteins. It interacts with different proteins to facilitate pro-apoptotic function, but its activity can be inhibited by other proteins. Additionally, p53 is involved in oxidative stress-induced necrosis and prevents CDK7 kinase activity in response to DNA damage. It also induces the transcription of specific non-coding RNAs and regulates the circadian clock. p53 Protein, Rat (His) is the recombinant rat-derived p53 protein, expressed by E. coli, with N-6*His labeled tag. The total length of p53 Protein, Rat (His) is 391 a.a., with molecular weight of ~50 kDa.

The p53 protein acts as a tumor suppressor in various tumor types and can induce growth arrest or apoptosis depending on the specific circumstances and cell type. It plays a crucial role in regulating the cell cycle by acting as a trans-activator that negatively controls cell division by regulating a group of genes essential for this process. One of the genes activated by p53 is an inhibitor of cyclin-dependent kinases. Apoptosis can be triggered either through the stimulation of BAX and FAS antigen expression or by repressing Bcl-2 expression. Its pro-apoptotic function is facilitated by its interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2. However, this activity is inhibited when PPP1R13L/iASPP displaces the interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2. Additionally, p53, in cooperation with mitochondrial PPIF, is involved in activating oxidative stress-induced necrosis, which is largely independent of transcription. In response to DNA damage, p53 prevents CDK7 kinase activity by associating with the CAK complex, thereby halting cell cycle progression. Moreover, p53 induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1, which participate in TP53-dependent transcriptional repression leading to apoptosis and potentially influence cell-cycle regulation. Furthermore, p53 regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2.

Rat

E. coli

N-6*His

P10361 (1M-391D)

24842  [NCBI]

MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

Approximately 50 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.