1. Recombinant Proteins
  2. Others
  3. PANP/C12orf53 Protein, Human (HEK293, Fc)

PANP/C12orf53 Protein acts as a neural tissue ligand for PILRA, indicating its potential role in immune regulation in this context. PANP/C12orf53 Protein, Human (HEK293, Fc) is the recombinant human-derived PANP/C12orf53 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PANP/C12orf53 Protein acts as a neural tissue ligand for PILRA, indicating its potential role in immune regulation in this context. PANP/C12orf53 Protein, Human (HEK293, Fc) is the recombinant human-derived PANP/C12orf53 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

PANP/C12orf53 Protein functions as a ligand specifically for PILRA in neural tissues, suggesting its potential involvement in immune regulation within this context.

Biological Activity

Measured by the ability of the immobilized protein to support the adhesion of Neuro‑2A mouse neuroblastoma cells. The ED50 for this effect is 33.88 ng/mL, corresponding to a specific activity is 2.952×104 units/mg.

  • Measured by the ability of the immobilized protein to support the adhesion of Neuro‑2A mouse neuroblastoma cells. The ED50 for this effect is 33.88 ng/mL, corresponding to a specific activity is 2.952×104 units/mg.
Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q8IYJ0-1 (S32-P178)

Gene ID
Molecular Construction
N-term
PANP (S32-P178)
Accession # Q8IYJ0-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
PILR alpha-associated neural protein; C12orf53; PANP; PIANP
AA Sequence

SSSSPRTPPAPARPPCARGGPSAPRHVCVWERAPPPSRSPRVPRSRRQVLPGTAPPATPSGFEEGPPSSQYPWAIVWGPTVSREDGGDPNSANPGFLDYGFAAPHGLATPHPNSDSMRGDGDGLILGEAPATLRPFLFGGRGEGVDP

Molecular Weight

Approximately 50-65 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PANP/C12orf53 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PANP/C12orf53 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PANP/C12orf53 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P77461
Quantity:
MCE Japan Authorized Agent: