1. Recombinant Proteins
  2. Others
  3. PC4/SUB1 Protein, Human (His)

PC4/SUB1 Protein, Human (His)

Cat. No.: HY-P74650
COA Handling Instructions

The PC4/SUB1 protein acts as a multifunctional coactivator that cooperates with TAF to promote functional interactions between upstream activators and the general transcription machinery. Its role extends to the potential stability of multiprotein transcription complexes. PC4/SUB1 Protein, Human (His) is the recombinant human-derived PC4/SUB1 protein, expressed by E. coli , with N-His labeled tag. The total length of PC4/SUB1 Protein, Human (His) is 127 a.a., with molecular weight of ~19 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $45 In-stock
10 μg $75 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PC4/SUB1 protein acts as a multifunctional coactivator that cooperates with TAF to promote functional interactions between upstream activators and the general transcription machinery. Its role extends to the potential stability of multiprotein transcription complexes. PC4/SUB1 Protein, Human (His) is the recombinant human-derived PC4/SUB1 protein, expressed by E. coli , with N-His labeled tag. The total length of PC4/SUB1 Protein, Human (His) is 127 a.a., with molecular weight of ~19 kDa.

Background

PC4/SUB1, also known as positive cofactor 4, is a general coactivator with a pivotal role in facilitating functional interactions between upstream activators and the general transcriptional machinery. It functions cooperatively with TAFs (TBP-associated factors) and is implicated in stabilizing multiprotein transcription complexes during gene expression. PC4/SUB1 demonstrates the ability to bind both single-stranded DNA and, in vitro, non-specifically to double-stranded DNA (dsDNA), indicating a versatile DNA-binding capability. Structurally, it forms homodimers, suggesting a cooperative arrangement that may enhance its functional properties. Additionally, PC4/SUB1 interacts with CSTF2, further emphasizing its involvement in diverse cellular processes related to transcriptional regulation. Ongoing research may unveil more insights into the specific mechanisms and regulatory functions of PC4/SUB1 in gene expression.

Species

Human

Source

E. coli

Tag

N-His

Accession

P53999 (M1-L127)

Gene ID
Molecular Construction
N-term
His
PC4 (M1-L127)
Accession # P53999
C-term
Synonyms
Activated RNA polymerase II transcriptional coactivator p15; PC4; p14; SUB1; RPO2TC1
AA Sequence

MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Molecular Weight

Approximately 16 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PC4/SUB1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PC4/SUB1 Protein, Human (His)
Cat. No.:
HY-P74650
Quantity:
MCE Japan Authorized Agent: