PC4/SUB1 Protein, Human (His)
Based on 1 Customer Validation
The PC4/SUB1 protein acts as a multifunctional coactivator that cooperates with TAF to promote functional interactions between upstream activators and the general transcription machinery. Its role extends to the potential stability of multiprotein transcription complexes. PC4/SUB1 Protein, Human (His) is the recombinant human-derived PC4/SUB1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PC4/SUB1 protein acts as a multifunctional coactivator that cooperates with TAF to promote functional interactions between upstream activators and the general transcription machinery. Its role extends to the potential stability of multiprotein transcription complexes. PC4/SUB1 Protein, Human (His) is the recombinant human-derived PC4/SUB1 protein, expressed by E. coli , with N-His labeled tag.
PC4/SUB1, also known as positive cofactor 4, is a general coactivator with a pivotal role in facilitating functional interactions between upstream activators and the general transcriptional machinery. It functions cooperatively with TAFs (TBP-associated factors) and is implicated in stabilizing multiprotein transcription complexes during gene expression. PC4/SUB1 demonstrates the ability to bind both single-stranded DNA and, in vitro, non-specifically to double-stranded DNA (dsDNA), indicating a versatile DNA-binding capability. Structurally, it forms homodimers, suggesting a cooperative arrangement that may enhance its functional properties. Additionally, PC4/SUB1 interacts with CSTF2, further emphasizing its involvement in diverse cellular processes related to transcriptional regulation. Ongoing research may unveil more insights into the specific mechanisms and regulatory functions of PC4/SUB1 in gene expression.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P53999 (M1-L127)
-
Molecular Construction
-
N-term
-
His
-
PC4 (M1-L127)
Accession # P53999 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SUB1; P15; SUB1 Regulator Of Transcription; SUB1 Homolog, Transcriptional Regulator; PC4; SUB1 Homolog; P14; Activated RNA Polymerase II Transcription Cofactor 4; Activated RNA Polymerase II Transcriptional Coactivator P15; SUB1 Homolog (S. Cerevisiae); P
-
AA Sequence
MPKSKELVSSSSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL
-
Predicted Molecular Mass
14.4 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
