Copy Link Print Information

PD-L2 Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PD-L2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for PD-L2 Protein, Mouse (HEK293, His)
  • PD-L2 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The PD-L2 Protein assumes a critical role in the costimulatory signal necessary for T-cell proliferation and IFNG production, operating in a PDCD1-independent manner. While its interaction with PDCD1 can inhibit T-cell proliferation by impeding cell cycle progression and cytokine production, PD-L2 itself is intricately involved in fostering these immune responses. The dynamic interplay between PD-L2 and PDCD1 highlights the regulatory mechanisms at play, emphasizing the protein's dual role in promoting or inhibiting T-cell activation based on its interactions within the immune signaling network.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED50 for this effect is 0.7202 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED50 for this effect is 0.7202 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q9WUL5 (L20-R219)

  • Gene ID
    58205  [NCBI]
  • Molecular Construction
    • N-term
    • PD-L2 (L20-R219)
      Accession # Q9WUL5
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    PDCD1LG2; B7 Dendritic Cell Molecule; Programmed Cell Death 1 Ligand 2; Programmed Death Ligand 2; PD-L2; Butyrophilin B7-DC; CD273; PDCD1 Ligand 2; B7-DC; PDCD1L2; PDL2; PD-1-Ligand 2; B7DC; CD273 Antigen; BA574F11.2; PD-1 Ligand 2; Btdc

  • AA Sequence

    LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED50 for this effect is 0.7202 μg/mL.

  • PD-L2 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for PD-L2 Protein, Mouse (HEK293, His)
  • Experimental Validation Results for PD-L2 Protein, Mouse (HEK293, His)
  • PD-L2 Protein, Mouse (HEK293, His) Product Image