PD-L2 Protein, Mouse (HEK293, His)

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

The PD-L2 Protein assumes a critical role in the costimulatory signal necessary for T-cell proliferation and IFNG production, operating in a PDCD1-independent manner. While its interaction with PDCD1 can inhibit T-cell proliferation by impeding cell cycle progression and cytokine production, PD-L2 itself is intricately involved in fostering these immune responses. The dynamic interplay between PD-L2 and PDCD1 highlights the regulatory mechanisms at play, emphasizing the protein's dual role in promoting or inhibiting T-cell activation based on its interactions within the immune signaling network.

Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED₅₀ for this effect is 0.7202 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED₅₀ for this effect is 0.7202 μg/mL.

Mouse

HEK293

C-His

Q9WUL5 (L20-R219)

58205  [NCBI]

Extracellular Domain

LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

31-40 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.