1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins
  4. B7-DC/PD-L2/CD273
  5. PD-L2 Protein, Mouse (HEK293, His)

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The PD-L2 Protein assumes a critical role in the costimulatory signal necessary for T-cell proliferation and IFNG production, operating in a PDCD1-independent manner. While its interaction with PDCD1 can inhibit T-cell proliferation by impeding cell cycle progression and cytokine production, PD-L2 itself is intricately involved in fostering these immune responses. The dynamic interplay between PD-L2 and PDCD1 highlights the regulatory mechanisms at play, emphasizing the protein's dual role in promoting or inhibiting T-cell activation based on its interactions within the immune signaling network.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED50 for this effect is 0.7202 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Mouse PD-L2 at 5 μg/mL (100 μL/well) can bind Mouse PD-1. The ED50 for this effect is 0.7202 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q9WUL5 (L20-R219)

Gene ID
Molecular Construction
N-term
PD-L2 (L20-R219)
Accession # Q9WUL5
His
C-term
Protein Length

Extracellular Domain

Synonyms
Programmed cell death 1 ligand 2; PD-1 ligand 2; PD-L2; B7-DC; CD273
AA Sequence

LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

Molecular Weight

Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PD-L2 Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PD-L2 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P73369
Quantity:
MCE Japan Authorized Agent: