PD-L2 Protein, Rat (HEK293, His)

Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 is consist of one IgV and one IgC domain, and is involved in the costimulatory signal, negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner. Interaction of Pdcd1lg2 with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. The interaction of Pdcd1lg2 with PD-1 boosts tolerance of T-cells, induces an inhibitory effect on T-cell activation/proliferation, increases the conversion of T helper cells into Foxp3+ Treg cells, and prevents cytolysis of T cell in cancerous cells, and consequently causes cancer growth and suppresses the immune system. Pdcd1lg2 expresses chiefly on APCs such as non-hematopoietic tissues, myeloid dendritic cells, and macrophages, while Pdcd1lg is active in external side of plasma membrane and is a biomarker of pulmonary tuberculosis^[1][2][3][4].

1.Measured by its binding ability in a functional ELISA.Immobilized rat PDCD1LG2-His at 10 μg/mL (100 μl/well) can bind rat PDCD1-Fc, The EC₅₀ of rat PDCD1-Fc is 15-35 ng/mL.
2.Measured by its binding ability in a functional ELISA. When Recombinant Rat PD-L2 is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Rat PD-1 that produces 50% optimal binding response is 0.2136 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Rat PD‑L2 is coated at 1 μg/mL (100 μL/well), the concentration of Recombinant Rat PD-1 that produces 50% optimal binding response is 0.2136 μg/mL.

Rat

HEK293

C-His

D4AAV6 (L20-R219)

309304  [NCBI]

Partial

LFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPR

Approximately 35.7 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Bolandi N, et al. The Positive and Negative Immunoregulatory Role of B7 Family: Promising Novel Targets in Gastric Cancer Treatment. Int J Mol Sci. 2021 Oct 3;22(19):10719.  [Content Brief]

  [2]. Latchman Y, et al. PD-L2 is a second ligand for PD-1 and inhibits T cell activation. Nat Immunol. 2001 Mar;2(3):261-8.  [Content Brief]

  [3]. Tseng SY, et al. B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells. J Exp Med. 2001 Apr 2;193(7):839-46.  [Content Brief]

  [4]. Wang S, et al. Molecular modeling and functional mapping of B7-H1 and B7-DC uncouple costimulatory function from PD-1 interaction. J Exp Med. 2003 May 5;197(9):1083-91.  [Content Brief]