1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Atypical Kinases
  4. PDHK
  5. PDK1/PDHK1
  6. PDK1 Protein, Human (Inactive, sf9, His)

PDK1 protein is a key kinase that controls glucose and fatty acid metabolism by phosphorylating pyruvate dehydrogenase subunits PDHA1 and PDHA2. This molecular switch inhibits pyruvate dehydrogenase, fine-tunes metabolite flux and downregulates aerobic respiration. PDK1 Protein, Human (sf9, His) is the recombinant human-derived PDK1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock
50 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDK1 protein is a key kinase that controls glucose and fatty acid metabolism by phosphorylating pyruvate dehydrogenase subunits PDHA1 and PDHA2. This molecular switch inhibits pyruvate dehydrogenase, fine-tunes metabolite flux and downregulates aerobic respiration. PDK1 Protein, Human (sf9, His) is the recombinant human-derived PDK1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

PDK1, a pivotal kinase, exerts significant control over glucose and fatty acid metabolism by phosphorylating the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This phosphorylation event acts as a molecular switch, inhibiting pyruvate dehydrogenase activity and finely tuning metabolite flux through the tricarboxylic acid cycle. Consequently, PDK1 down-regulates aerobic respiration and impedes the conversion of pyruvate to acetyl-coenzyme A. Beyond its metabolic functions, PDK1 emerges as a critical player in cellular responses to hypoxia, where it plays a key role in promoting cell proliferation under oxygen-deprived conditions. Moreover, PDK1 serves a protective role by shielding cells against apoptosis triggered by hypoxia and oxidative stress, showcasing its multifaceted contributions to cellular homeostasis and stress response pathways.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

Q15118 (S29-A436)

Gene ID
Molecular Construction
N-term
His
PDK1 (S29-A436)
Accession # Q15118
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Pyruvate dehydrogenase kinase isoform 1; PDK1; PDHK1
AA Sequence

SSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA

Molecular Weight

Approximately 45 kDa

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDK1 Protein, Human (Inactive, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDK1 Protein, Human (Inactive, sf9, His)
Cat. No.:
HY-P73718
Quantity:
MCE Japan Authorized Agent: