PFDN2 Protein, Human (His)

The PFDN2 protein selectively binds to the cytoplasmic chaperone protein (c-CPN) and directs the protein for targeted transfer. It also interacts with nascent peptides and actively promotes correct folding in complex cellular environments. PFDN2 Protein, Human (His) is the recombinant human-derived PFDN2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PFDN2 Protein, Human (His) is 154 a.a., with molecular weight of ~19 kDa.

PFDN2 protein exhibits specific binding affinity to cytosolic chaperonin (c-CPN), facilitating the targeted transfer of proteins to this chaperone. Furthermore, PFDN2 interacts with nascent polypeptide chains, actively promoting their proper folding within an intricate cellular environment with numerous competing pathways for nonnative proteins. As a heterohexamer, PFDN2 comprises two PFD-alpha type and four PFD-beta type subunits. It plays a crucial role as part of the PAQosome complex, collaborating with other essential components such as R2TP complex members (RUVBL1, RUVBL2, RPAP3, and PIH1D1) and URI complex members (PFDN6, PDRG1, UXT, and URI1), as well as ASDURF, POLR2E, and DNAAF10/WDR92. This complex is integral to the biogenesis of various protein complexes. Notably, PFDN2 engages in phosphorylation-dependent interactions with URI1, demonstrating a growth-dependent manner of interaction.

Data is not available

Human

E. coli

N-6*His

Q9UHV9 (M1-S154)

5202  [NCBI]

MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS

Approximately 19 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.2 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween80, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.