1. Recombinant Proteins
  2. Others
  3. HPRT Protein, P. falciparum (His)

The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum. HPRT Protein, P. falciparum (His) is the recombinant HPRT protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the purine metabolism salvage pathway of the malaria-causing parasite Plasmodium falciparum. HPRT Protein, P. falciparum (His) is the recombinant HPRT protein, expressed by E. coli , with N-His labeled tag.

Background

pfHPRT (Plasmodium falciparum hypoxanthine-guanine phosphoribosyltransferase) protein is a member of the LDH/MDH (lactate dehydrogenase/malate dehydrogenase) superfamily. It plays a crucial role in the salvage pathway of purine metabolism in the malaria-causing parasite Plasmodium falciparum. pfHPRT catalyzes the conversion of hypoxanthine and guanine to their respective nucleotide forms, in the presence of phosphoribosyl pyrophosphate (PRPP). This enzymatic activity is essential for the parasite's survival, as it provides a means to generate purine nucleotides required for DNA and RNA synthesis. Due to its involvement in purine salvage, pfHPRT has been explored as a potential target for antimalarial drug development. Inhibition of pfHPRT could disrupt the parasite's purine metabolism, leading to the depletion of nucleotides and subsequent parasite death. Understanding the structure, function, and regulation of pfHPRT may contribute to the development of novel strategies to combat malaria.

Species

Others

Source

E. coli

Tag

N-His

Accession

Q8IJS1/CZT98374.1 (M1-L231)

Gene ID

810279

Molecular Construction
N-term
His
HPRT (M1-L231)
Accession # Q8IJS1/CZT98374.1
C-term
Protein Length

Partial

Synonyms
L-lactate dehydrogenase; PF3D7_1324900
AA Sequence

MPIPNNPGAGENAFDPVFVKDDDGYDLDSFMIPAHYKKYLTKVLVPNGVIKNRIEKLAYDIKKVYNNEEFHILCLLKGSRGFFTALLKHLSRIHNYSAVETSKPLFGEHYVRVKSYCNDQSTGTLEIVSEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKRTPLWNGFKADFVGFSIPDHFVVGYSLDYNEIFRDLDHCCLVNDEGKKKYKATSL

Predicted Molecular Mass
28.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

HPRT Protein, P. falciparum (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HPRT Protein, P. falciparum (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HPRT Protein, P. falciparum (His)
Cat. No.:
HY-P74637
Quantity:
MCE Japan Authorized Agent: