PIG3 Protein, Human (His)
Based on 1 Customer Validation
PIG3 is a key player in cellular processes, functioning as an enzyme that catalyzes NADPH-dependent quinone reduction. It exhibits moderate enzymatic activity towards β-naphthoquinone, with the para -quinone isomer (1,2-β-naphthoquinone) compared to the para -isomer (1,4-β-naphthoquinone). Obvious preference. PIG3 Protein, Human (His) is the recombinant human-derived PIG3 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PIG3 is a key player in cellular processes, functioning as an enzyme that catalyzes NADPH-dependent quinone reduction. It exhibits moderate enzymatic activity towards β-naphthoquinone, with the para -quinone isomer (1,2-β-naphthoquinone) compared to the para -isomer (1,4-β-naphthoquinone). Obvious preference. PIG3 Protein, Human (His) is the recombinant human-derived PIG3 protein, expressed by E. coli , with N-6*His labeled tag.
PIG3, or p53-induced gene 3, is a protein that catalyzes the NADPH-dependent reduction of quinones, showcasing a preference for the ortho-quinone isomer (1,2-beta-naphthoquinone) over the para isomer (1,4-beta-naphthoquinone). Additionally, PIG3 exhibits low enzymatic activity with beta-naphthoquinones and displays reductase activity for non-quinone compounds such as diamine and 2,6-dichloroindophenol in vitro. Beyond its enzymatic functions, PIG3 is involved in the generation of reactive oxygen species (ROS). This multifaceted role suggests that PIG3 may contribute to redox homeostasis by participating in quinone reduction and other reductase activities, while also being implicated in ROS production, highlighting its potential impact on cellular oxidative stress responses.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q53FA7 (M1-Q332)
-
Molecular Construction
-
N-term
-
6*His
-
PIG3 (M1-Q332)
Accession # Q53FA7 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
TP53I3; CDNA FLJ61719, Highly Similar To Quinone Oxidoreductase; Tumor Protein P53 Inducible Protein 3; Tumor Protein P53 Inducible Protein 3, Isoform CRA_c; PIG3; Tumor Protein P53-Inducible Protein 3; NADPH:Quinone Reductase PIG3; Quinone Oxidoreductase
-
AA Sequence
MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPVLDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ
-
Predicted Molecular Mass
36 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
