1. Recombinant Proteins
  2. Others
  3. PIN/DYNLL1 Protein, Human (His)

PIN/DYNLL1 Protein, Human (His)

Cat. No.: HY-P70048
COA Handling Instructions

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli, with N-6*His labeled tag. The total length of PIN/DYNLL1 Protein, Human (His) is 89 a.a., with molecular weight of ~14.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $145 In-stock
50 μg $400 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli, with N-6*His labeled tag. The total length of PIN/DYNLL1 Protein, Human (His) is 89 a.a., with molecular weight of ~14.0 kDa.

Background

PIN/DYNLL1 serves as a non-catalytic accessory component within the cytoplasmic dynein 1 complex, contributing to the linkage between dynein and its associated cargos and adapter proteins that modulate dynein activity. As part of the cytoplasmic dynein 1 complex, it functions as a motor for the retrograde movement of vesicles and organelles along microtubules. PIN/DYNLL1 likely plays a role in shaping or preserving the spatial arrangement of cytoskeletal structures. Additionally, it is involved in enhancing the transactivation functions of ESR1 and contributes to the nuclear localization of ESR1.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P63167 (M1-G89)

Gene ID
Molecular Construction
N-term
6*His
PIN (M1-G89)
Accession # P63167
C-term
Synonyms
rHuDynein light chain 1, cytoplasmic/DYNLL1, His; Dynein Light Chain 1 Cytoplasmic; 8 kDa Dynein Light Chain; DLC8; Dynein Light Chain LC8-Type 1; Protein Inhibitor of Neuronal Nitric Oxide Synthase; PIN; DYNLL1; DLC1; DNCL1; DNCLC1; HDLC1
AA Sequence

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

Molecular Weight

Approximately 14.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PIN/DYNLL1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PIN/DYNLL1 Protein, Human (His)
Cat. No.:
HY-P70048
Quantity:
MCE Japan Authorized Agent: