Copy Link Print Information

PIN/DYNLL1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • PIN/DYNLL1 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PIN/DYNLL1 acts as a non-catalytic accessory component in the cytoplasmic dynein 1 complex, connecting dynein to cargos and adapter proteins for dynein modulation. It functions as a motor for retrograde vesicle movement along microtubules, potentially influencing cytoskeletal structure. PIN/DYNLL1 enhances ESR1 transactivation and aids ESR1 nuclear localization. PIN/DYNLL1 Protein, Human (His) is the recombinant human-derived PIN/DYNLL1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PIN/DYNLL1 serves as a non-catalytic accessory component within the cytoplasmic dynein 1 complex, contributing to the linkage between dynein and its associated cargos and adapter proteins that modulate dynein activity. As part of the cytoplasmic dynein 1 complex, it functions as a motor for the retrograde movement of vesicles and organelles along microtubules. PIN/DYNLL1 likely plays a role in shaping or preserving the spatial arrangement of cytoskeletal structures. Additionally, it is involved in enhancing the transactivation functions of ESR1 and contributes to the nuclear localization of ESR1.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession

    P63167 (M1-G89)

  • Gene ID
    8655  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • PIN (M1-G89)
      Accession # P63167
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    DYNLL1; Dynein, Cytoplasmic, Light Polypeptide 1; Prev. DNCL1; 8 KDa Dynein Light Chain; DLC1; DNCLC1; DLC8; Cytoplasmic Dynein Light Polypeptide; PIN; Dynein Light Chain; Hdlc1; HDLC1; LC8; LC8a; Protein Inhibitor Of Neuronal Nitric Oxide Synthase; Dynei

  • AA Sequence

    MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG

  • Predicted Molecular Mass

    12.5 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 200 mM NaCl, 1 mM DTT, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PIN/DYNLL1 Protein, Human (His) Product Image
    1/16
  • PIN/DYNLL1 Protein, Human (His) Product Image