1. Recombinant Proteins
  2. Biotinylated Proteins
  3. Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His)

Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His)

Cat. No.: HY-P77147
Handling Instructions Technical Support

Placental Lactogen/CSH1 Protein, exclusive to pregnancy, orchestrates lactation, fetal growth, and metabolism. Its unique mode of action involves zinc-induced dimerization of the Prolactin Receptor (PRLR), distinct from the Growth Hormone Receptor (GHR). This specificity and structural versatility underline its pivotal role in intricate pregnancy-related processes and maternal physiology. Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived Placental Lactogen/CSH1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Placental Lactogen/CSH1 Protein, exclusive to pregnancy, orchestrates lactation, fetal growth, and metabolism. Its unique mode of action involves zinc-induced dimerization of the Prolactin Receptor (PRLR), distinct from the Growth Hormone Receptor (GHR). This specificity and structural versatility underline its pivotal role in intricate pregnancy-related processes and maternal physiology. Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived Placental Lactogen/CSH1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Placental Lactogen/CSH1 Protein, exclusively generated during pregnancy, plays a pivotal role in orchestrating lactation, fetal growth, and metabolic processes. Remarkably, it exhibits a unique mode of action, as it does not interact with the Growth Hormone Receptor (GHR). Instead, its activation is exclusively mediated through zinc-induced dimerization of the Prolactin Receptor (PRLR). This distinctive mechanism contributes to the protein's specificity and underscores its significance in the intricate processes associated with pregnancy and maternal physiology. Notably, Placental Lactogen/CSH1 can exist in both monomeric and dimeric forms, highlighting its structural versatility.

Species

Human

Source

HEK293

Tag

C-His

Accession

P0DML2 (V27-F217)

Gene ID
Molecular Construction
N-term
CSH1 (V27-F217)
Accession # P0DML2
His
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
Chorionic Somatomammotropin Hormone; Placental Lactogen; PL; CSH2
AA Sequence

VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF

Predicted Molecular Mass
23.7 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Placental Lactogen/CSH1 Protein, Human (Biotinylated, HEK293, His)
Cat. No.:
HY-P77147
Quantity:
MCE Japan Authorized Agent: