PLBD2 Protein, Rat (His-SUMO)
The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PLBD2 protein is a putative phospholipase that may participate in cellular processes by interacting with IGF2R. Although the function and mechanism of the enzyme are unclear, its association with IGF2R suggests involvement in the insulin-like growth factor 2 receptor-related signaling pathway. PLBD2 Protein, Rat (His-SUMO) is the recombinant rat-derived PLBD2 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
PLBD2 Protein, identified as a putative phospholipase, exhibits a potential role in cellular processes by interacting with IGF2R. While the specific enzymatic functions and detailed mechanisms of PLBD2 remain to be fully elucidated, its interaction with IGF2R suggests a potential involvement in cellular signaling pathways related to insulin-like growth factor 2 receptor-mediated processes. The precise contribution of PLBD2 in cellular homeostasis, phospholipid metabolism, or other regulatory pathways warrants further investigation. The interaction with IGF2R adds a layer of complexity to PLBD2's potential functions, suggesting a connection to cellular pathways associated with growth and development. Further studies are needed to unravel the intricate role of PLBD2 in cellular physiology and its functional implications in cellular signaling cascades.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q4QQW8 (G36-D585)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
PLBD2 (G36-D585)
Accession # Q4QQW8 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLBD2; PLBL2; Phospholipase B Domain Containing 2; Phospholipase B-Like 2 32 KDa Form; P76; Phospholipase B-Like 2 45 KDa Form; Lamina Ancestor Homolog 2; Putative Phospholipase B-Like 2; LAMA-Like Protein 2; PLB Homolog 2 (Dictyostelium); Mannose-6-Phosp
-
AA Sequence
GALPTLGPGWRRQNPEPPASRTRSLLLDAASGQLRLEYGFHPDAVAWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKSFLEANLEWMQREMELSPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFNIKPLGFLLLQISGDLEDLEPALNKTNTKPSVGSGSCSALIKLLPGSHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLIAGNNLIFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWADVFRRFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFESVFNASGLQALVAQYGDWFSYTRNPRAKIFQRDQSLVEDVDTMVRLMRYNDFLHDPLSLCEACSPKPNAENAISARSDLNPANGSYPFQALRQRAHGGIDVKVTSVALAKYMSMLAASGPTWDQLPPFQWSKSPFHNMLHMGQPDLWMFSPVKVPWD
-
Predicted Molecular Mass
77.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
