PMP2 Protein, Human (His)
Based on 1 Customer Validation
The PMP2 protein may act as a lipid transporter within Schwann cells, suggesting a role in lipid transport and cellular homeostasis. PMP2 may also bind cholesterol, suggesting involvement in cholesterol-related pathways. PMP2 Protein, Human (His) is the recombinant human-derived PMP2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The PMP2 protein may act as a lipid transporter within Schwann cells, suggesting a role in lipid transport and cellular homeostasis. PMP2 may also bind cholesterol, suggesting involvement in cholesterol-related pathways. PMP2 Protein, Human (His) is the recombinant human-derived PMP2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
The PMP2 protein is implicated in potentially serving as a lipid transport protein within Schwann cells, suggesting its involvement in the intricate processes of lipid transport and cellular homeostasis. Additionally, PMP2 may play a role in binding cholesterol, indicating its potential participation in cholesterol-related pathways or cellular functions. Structurally, PMP2 functions as a monomer, underscoring its individual unit within the cellular machinery. The precise mechanisms by which PMP2 contributes to lipid transport and cholesterol binding, as well as its specific role in Schwann cell biology, remain areas of interest, warranting further exploration to unravel its functional significance and molecular interactions in the context of lipid homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P02689 (M1-V132)
-
Molecular Construction
-
N-term
-
6*His
-
PMP2 (M1-V132)
Accession # P02689 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PMP2; MP2; Peripheral Myelin Protein 2; Myelin P2 Protein; M-FABP; CMT1G; FABP8; P2
-
AA Sequence
MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
-
Predicted Molecular Mass
17.1 kDa
-
Molecular Weight
Approximately 14-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 10% trehalose, 100 mM NaCl, 0.05% Tween 80, pH 4.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)