PPAR gamma Protein, Human (C-His, solution)
Based on 1 Customer Validation
The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His, solution) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His, solution) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.
Background
PPAR gamma Protein, a nuclear receptor, binds to peroxisome proliferators such as hypolipidemic drugs and fatty acids. Upon ligand activation, the nuclear receptor interacts with specific PPAR response elements (PPRE) on DNA, modulating the transcription of target genes like acyl-CoA oxidase and thereby controlling the peroxisomal beta-oxidation pathway of fatty acids. It plays a pivotal role as a key regulator in adipocyte differentiation and glucose homeostasis. Additionally, PPAR gamma acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses. In the context of cardiovascular circadian rhythms, it regulates the transcription of BMAL1 in blood vessels. Furthermore, in response to microbial infection, particularly treatment with M.tuberculosis or its lipoprotein LpqH, PPAR gamma modulates phosphorylation of MAPK p38 and IL-6 production, suggesting its involvement in immune responses during microbial challenges.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P37231-1 (D238-D503)
-
Molecular Construction
-
N-term
-
PPAR gamma (D238-D503)
Accession # P37231-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of NR LBD domain
-
Synonyms
PPARG; PPARG5; Peroxisome Proliferator Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma Splicing; NR1C3; Peroxisome Proliferative Activated Receptor, Gamma; Peroxisome Proliferator-Activated Receptor Gamma; Peroxisome Proliferato
-
AA Sequence
DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD
-
Predicted Molecular Mass
30.4 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 500 mM arginine, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)