1. Recombinant Proteins
  2. Receptor Proteins
  3. Nuclear Receptor Superfamily
  4. Peroxisome Proliferator-activated Receptor
  5. PPAR gamma
  6. PPAR gamma Protein, Human (C-His)

PPAR gamma Protein, Human (C-His)

Cat. No.: HY-P700275
COA Handling Instructions

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg $290 In-stock
100 μg $490 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.

Background

PPAR gamma Protein, a nuclear receptor, binds to peroxisome proliferators such as hypolipidemic drugs and fatty acids. Upon ligand activation, the nuclear receptor interacts with specific PPAR response elements (PPRE) on DNA, modulating the transcription of target genes like acyl-CoA oxidase and thereby controlling the peroxisomal beta-oxidation pathway of fatty acids. It plays a pivotal role as a key regulator in adipocyte differentiation and glucose homeostasis. Additionally, PPAR gamma acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses. In the context of cardiovascular circadian rhythms, it regulates the transcription of BMAL1 in blood vessels. Furthermore, in response to microbial infection, particularly treatment with M.tuberculosis or its lipoprotein LpqH, PPAR gamma modulates phosphorylation of MAPK p38 and IL-6 production, suggesting its involvement in immune responses during microbial challenges.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P37231-1 (D238-D503)

Gene ID
Molecular Construction
N-term
PPAR gamma (D238-D503)
Accession # P37231-1
6*His
C-term
Synonyms
PPAR-γ-LBD
AA Sequence

DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

Molecular Weight

Approximately 30 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of sterile 50mM Tris, 300mM NaCl, 500 mM arginine, pH 8.0, 10% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PPAR gamma Protein, Human (C-His)
Cat. No.:
HY-P700275
Quantity:
MCE Japan Authorized Agent: