PPAR gamma Protein, Human (C-His, solution)

Customer Review

Based on 1 Customer Validation

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His, solution) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PPAR gamma protein is a nuclear receptor that binds to peroxisome proliferators and is activated upon ligand binding to specific PPREs on DNA. It regulates target gene transcription and controls fatty acid metabolism. PPAR gamma Protein, Human (C-His, solution) is the recombinant human-derived PPAR gamma protein, expressed by E. coli , with C-6*His labeled tag.

Background

PPAR gamma Protein, a nuclear receptor, binds to peroxisome proliferators such as hypolipidemic drugs and fatty acids. Upon ligand activation, the nuclear receptor interacts with specific PPAR response elements (PPRE) on DNA, modulating the transcription of target genes like acyl-CoA oxidase and thereby controlling the peroxisomal beta-oxidation pathway of fatty acids. It plays a pivotal role as a key regulator in adipocyte differentiation and glucose homeostasis. Additionally, PPAR gamma acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated pro-inflammatory responses. In the context of cardiovascular circadian rhythms, it regulates the transcription of BMAL1 in blood vessels. Furthermore, in response to microbial infection, particularly treatment with M.tuberculosis or its lipoprotein LpqH, PPAR gamma modulates phosphorylation of MAPK p38 and IL-6 production, suggesting its involvement in immune responses during microbial challenges.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PPAR gamma (D238-D503)
      Accession # P37231-1
    • 6*His
    • C-term
  • Protein Length

    Full Length of NR LBD domain

  • Synonyms

    PPARG; PPARG5; Peroxisome Proliferator Activated Receptor Gamma; Peroxisome Proliferator-Activated Receptor-Gamma Splicing; NR1C3; Peroxisome Proliferative Activated Receptor, Gamma; Peroxisome Proliferator-Activated Receptor Gamma; Peroxisome Proliferato

  • AA Sequence

    DLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD

  • Predicted Molecular Mass

    30.4 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 500 mM arginine, pH 8.0, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00