PPIC Protein, Human (Trx-His)

PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag. The total length of PPIC Protein, Human (Trx-His) is 152 a.a., with molecular weight of ~34.0 kDa.

PPIC Protein emerges as a peptidyl-prolyl cis-trans isomerase (PPIase), actively facilitating the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, a crucial step in the intricate process of protein folding. By catalyzing these conformational changes, PPIC is anticipated to play a pivotal role in ensuring the correct folding and maturation of proteins, contributing to cellular protein homeostasis. The ability of PPIC to isomerize proline imidic peptide bonds underscores its significance in modulating the structural dynamics of polypeptides, ultimately influencing their functional integrity. This multifunctional enzymatic activity positions PPIC as a key player in cellular physiology, emphasizing the need for further exploration to uncover the specific molecular mechanisms and cellular pathways through which PPIC actively contributes to the intricate world of protein folding.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-Trx;N-6*His

P45877 (K31-D182)

5480  [NCBI]

KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD

Approximately 34.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.