PPIC Protein, Human (Trx-His)
Based on 1 Customer Validation
PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PPIC protein is a peptidyl-prolyl cis-trans isomerase (PPIase) that actively catalyzes the cis-trans isomerization of prolyl imide peptide bonds, which is a key step in protein folding. Its role in promoting conformational changes ensures correct folding and maturation of proteins, contributing to cellular proteostasis. PPIC Protein, Human (Trx-His) is the recombinant human-derived PPIC protein, expressed by E. coli , with N-Trx, N-6*His labeled tag.
PPIC Protein emerges as a peptidyl-prolyl cis-trans isomerase (PPIase), actively facilitating the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, a crucial step in the intricate process of protein folding. By catalyzing these conformational changes, PPIC is anticipated to play a pivotal role in ensuring the correct folding and maturation of proteins, contributing to cellular protein homeostasis. The ability of PPIC to isomerize proline imidic peptide bonds underscores its significance in modulating the structural dynamics of polypeptides, ultimately influencing their functional integrity. This multifunctional enzymatic activity positions PPIC as a key player in cellular physiology, emphasizing the need for further exploration to uncover the specific molecular mechanisms and cellular pathways through which PPIC actively contributes to the intricate world of protein folding.
Measured by its ability to convert the substrate, Suc-AAPF-pNA, from Cis to Trans formation. The specific activity is 776.34 pmol/min/μg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Trx;N-6*His
-
Accession
P45877 (K31-D182)
-
Molecular Construction
-
N-term
-
Trx-6*His
-
PPIC (K31-D182)
Accession # P45877 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PPIC; Peptidyl-Prolyl Cis-Trans Isomerase C; Peptidylprolyl Isomerase C; Rotamase C; CYPC; PPIase C; Cyclophilin C; Parvulin
-
AA Sequence
KRGPSVTAKVFFDVRIGDKDVGRIVIGLFGKVVPKTVENFVALATGEKGYGYKGSKFHRVIKDFMIQGGDITTGDGTGGVSIYGETFPDENFKLKHYGIGWVSMANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVIDGMTVVHSIELQATD
-
Predicted Molecular Mass
33.8 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 10% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
