Copy Link Print Information

PPIL2 Protein, Human (His)

PPIL2 exhibits ubiquitin-protein ligase activity, acting as an E3 ligase or ubiquitin-ubiquitin ligase, promoting “Lys-48”-linked polyubiquitination for proteasomal degradation of substrates.It acts as a chaperone to help transport BSG/Basigin to the cell membrane.PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E.coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • PPIL2 Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PPIL2 exhibits ubiquitin-protein ligase activity, acting as an E3 ligase or ubiquitin-ubiquitin ligase, promoting “Lys-48”-linked polyubiquitination for proteasomal degradation of substrates.It acts as a chaperone to help transport BSG/Basigin to the cell membrane.PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E.coli , with N-His labeled tag.

Background

PPIL2, known for its ubiquitin-protein ligase activity, functions as both an E3 ubiquitin protein ligase and an ubiquitin-ubiquitin ligase, facilitating the elongation of ubiquitin chains on substrates. Through the mediation of 'Lys-48'-linked polyubiquitination, it has the potential to target proteins for proteasomal degradation. Additionally, PPIL2 may operate as a chaperone, contributing to the transport of proteins like BSG/Basigin to the cell membrane. Despite its ubiquitin ligase function, PPIL2 is likely an inactive peptidyl-prolyl cis-trans isomerase. As part of the minor spliceosome, PPIL2 plays a role in the splicing of U12-type introns in pre-mRNAs, indicating its involvement in the intricate process of RNA splicing.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession

    Q13356-2 (G280-P457)

  • Gene ID
    23759  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • PPIL2 (G280-P457)
      Accession # Q13356-2
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PPIL2; PPIase; Peptidylprolyl Isomerase Like 2; Peptidylprolyl Isomerase (Cyclophilin)-Like 2, Isoform CRA_d; CYC4; RING-Type E3 Ubiquitin Transferase Isomerase-Like 2; Probable Inactive Peptidyl-Prolyl Cis-Trans Isomerase-Like 2; Nitric Oxide Synthase-In

  • AA Sequence

    GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PPIL2 Protein, Human (His) Product Image
    1/16
  • PPIL2 Protein, Human (His) Product Image