PPIL2 Protein, Human (His)
PPIL2 exhibits ubiquitin-protein ligase activity, acting as an E3 ligase or ubiquitin-ubiquitin ligase, promoting “Lys-48”-linked polyubiquitination for proteasomal degradation of substrates.It acts as a chaperone to help transport BSG/Basigin to the cell membrane.PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E.coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
PPIL2 exhibits ubiquitin-protein ligase activity, acting as an E3 ligase or ubiquitin-ubiquitin ligase, promoting “Lys-48”-linked polyubiquitination for proteasomal degradation of substrates.It acts as a chaperone to help transport BSG/Basigin to the cell membrane.PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E.coli , with N-His labeled tag.
PPIL2, known for its ubiquitin-protein ligase activity, functions as both an E3 ubiquitin protein ligase and an ubiquitin-ubiquitin ligase, facilitating the elongation of ubiquitin chains on substrates. Through the mediation of 'Lys-48'-linked polyubiquitination, it has the potential to target proteins for proteasomal degradation. Additionally, PPIL2 may operate as a chaperone, contributing to the transport of proteins like BSG/Basigin to the cell membrane. Despite its ubiquitin ligase function, PPIL2 is likely an inactive peptidyl-prolyl cis-trans isomerase. As part of the minor spliceosome, PPIL2 plays a role in the splicing of U12-type introns in pre-mRNAs, indicating its involvement in the intricate process of RNA splicing.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q13356-2 (G280-P457)
-
Molecular Construction
-
N-term
-
His
-
PPIL2 (G280-P457)
Accession # Q13356-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PPIL2; PPIase; Peptidylprolyl Isomerase Like 2; Peptidylprolyl Isomerase (Cyclophilin)-Like 2, Isoform CRA_d; CYC4; RING-Type E3 Ubiquitin Transferase Isomerase-Like 2; Probable Inactive Peptidyl-Prolyl Cis-Trans Isomerase-Like 2; Nitric Oxide Synthase-In
-
AA Sequence
GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)