PPIL2 Protein, Human (His)

PPIL2 exhibits ubiquitin-protein ligase activity, serving as an E3 ligase or ubiquitin-ubiquitin ligase, promoting 'Lys-48'-linked polyubiquitination for proteasomal degradation of substrates. It may function as a chaperone, aiding the transport of BSG/Basigin to the cell membrane. Additionally, as part of the minor spliceosome, PPIL2 plays a role in splicing U12-type introns in pre-mRNAs, though it likely lacks peptidyl-prolyl cis-trans isomerase activity. PPIL2 Protein, Human (His) is the recombinant human-derived PPIL2 protein, expressed by E. coli , with N-His labeled tag. The total length of PPIL2 Protein, Human (His) is 178 a.a., with molecular weight of ~24 kDa.

PPIL2, known for its ubiquitin-protein ligase activity, functions as both an E3 ubiquitin protein ligase and an ubiquitin-ubiquitin ligase, facilitating the elongation of ubiquitin chains on substrates. Through the mediation of 'Lys-48'-linked polyubiquitination, it has the potential to target proteins for proteasomal degradation. Additionally, PPIL2 may operate as a chaperone, contributing to the transport of proteins like BSG/Basigin to the cell membrane. Despite its ubiquitin ligase function, PPIL2 is likely an inactive peptidyl-prolyl cis-trans isomerase. As part of the minor spliceosome, PPIL2 plays a role in the splicing of U12-type introns in pre-mRNAs, indicating its involvement in the intricate process of RNA splicing.

Human

E. coli

N-His

Q13356-2 (G280-P457)

23759  [NCBI]

GYVRLHTNKGDLNLELHCDLTPKTCENFIRLCKKHYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQERKTQLKVAP

Approximately 24 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.