PRDX4 Protein, Human (His)

PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag.

PRDX4, a thiol-specific peroxidase, functions as an enzymatic catalyst in the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Its pivotal role in cellular protection involves detoxifying peroxides and serving as a sensor for hydrogen peroxide-mediated signaling events. Additionally, PRDX4 contributes to the regulation of NF-kappa-B activation in the cytosol by modulating the phosphorylation of I-kappa-B-alpha. This multifaceted activity underscores the significance of PRDX4 in cellular redox homeostasis and its potential impact on intracellular signaling pathways.

Defined as the amount of hydroperoxide that 1μg of PRDX4 can reduce at 25°C for 1 minute. The specific activity is 1875- 2063.33 pmol/min/μg, as measured under the described conditions.

Materials
30% H₂O₂
PRDX4 Protein, Human (His) (HY-P71232)

Procedure
1. Dilute 30% hydrogen peroxide to concentrations of 0.3058, 0.1529, 0.076, 0.038, 0.019, 0.0096, 0.0047, 0 mol/L. Add 100 μL/well and measure the absorbance at 240 nm.
2. Dilute H₂O₂ to 0.2 mol/L.
3. Dilute the Human PRDX4 to 1000 μg/mL.
4. In a 96-well plate, add 90 μL of 0.2 mol/L H₂O₂ and 10 μL of 1000 μg/mL protein.
5. Read the initial absorbance at 240 nm.
6. Incubate at room temperature for 20 minutes and read the absorbance again.
7. Calculate specific activity:

Human

E. coli

N-6*His

Q13162 (W38-N271)

10549  [NCBI]

Full Length of Mature Protein

WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

27-30 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.