PRDX4 Protein, Human (His)

PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag. The total length of PRDX4 Protein, Human (His) is 234 a.a., with molecular weight of 27-30 kDa.

PRDX4, a thiol-specific peroxidase, functions as an enzymatic catalyst in the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Its pivotal role in cellular protection involves detoxifying peroxides and serving as a sensor for hydrogen peroxide-mediated signaling events. Additionally, PRDX4 contributes to the regulation of NF-kappa-B activation in the cytosol by modulating the phosphorylation of I-kappa-B-alpha. This multifaceted activity underscores the significance of PRDX4 in cellular redox homeostasis and its potential impact on intracellular signaling pathways.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

E. coli

N-6*His

Q13162 (W38-N271)

10549  [NCBI]

WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

27-30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.