PRDX4 Protein, Human (His)
Based on 1 publication(s) in Google Scholar
PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PRDX4, a thiol-specific peroxidase, enzymatically reduces hydrogen peroxide and organic hydroperoxides, crucial for cellular protection. It detoxifies peroxides, acts as a sensor for hydrogen peroxide-mediated signaling, and contributes to NF-kappa-B activation regulation. PRDX4's multifaceted activity underscores its significance in cellular redox homeostasis and potential impact on intracellular signaling. PRDX4 Protein, Human (His) is the recombinant human-derived PRDX4 protein, expressed by E. coli , with N-6*His labeled tag.
PRDX4, a thiol-specific peroxidase, functions as an enzymatic catalyst in the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Its pivotal role in cellular protection involves detoxifying peroxides and serving as a sensor for hydrogen peroxide-mediated signaling events. Additionally, PRDX4 contributes to the regulation of NF-kappa-B activation in the cytosol by modulating the phosphorylation of I-kappa-B-alpha. This multifaceted activity underscores the significance of PRDX4 in cellular redox homeostasis and its potential impact on intracellular signaling pathways.
Defined as the amount of hydroperoxide that 1μg of PRDX4 can reduce at 25°C for 1 minute. The specific activity is 1875- 2063.33 pmol/min/μg, as measured under the described conditions.
Assay Procedure
Materials
30% H2O2
PRDX4 Protein, Human (His) (HY-P71232)
Procedure
1. Dilute 30% hydrogen peroxide to concentrations of 0.3058, 0.1529, 0.076, 0.038, 0.019, 0.0096, 0.0047, 0 mol/L. Add 100 μL/well and measure the absorbance at 240 nm.
2. Dilute H2O2 to 0.2 mol/L.
3. Dilute the Human PRDX4 to 1000 μg/mL.
4. In a 96-well plate, add 90 μL of 0.2 mol/L H2O2 and 10 μL of 1000 μg/mL protein.
5. Read the initial absorbance at 240 nm.
6. Incubate at room temperature for 20 minutes and read the absorbance again.
7. Calculate specific activity:
Specific Activity (pmol/min/μg) = | Adjusted Abs * (OD) x Conversion Factor ** (pmol/RFU) |
| Incubation time (min) x amount of enzyme (μg) |
*Adjusted for Substrate Blank
**Derived using calibration standard
Per Well:
Human PRDX4: 10 μg
H2O2: 0.18 M
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Pharm Biomed Anal
Target proteins profiling of irreversible kinase inhibitor pelitinib and discovery of degradation of PRDX4 by label free chemoproteomics. [Abstract]2023 Jun 15:230:115398. PMID: 37084663
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q13162 (W38-N271)
-
Molecular Construction
-
N-term
-
6*His
-
PRDX4 (W38-N271)
Accession # Q13162 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRDX4; Peroxiredoxin-4; Peroxiredoxin 4; Prx-IV; AOE37-2; Epididymis Secretory Sperm Binding Protein Li 97n; Thioredoxin-Dependent Peroxide Reductase A0372; Thioredoxin Peroxidase (Antioxidant Enzyme); Thioredoxin-Dependent Peroxiredoxin 4; Thioredoxin-De
-
AA Sequence
WETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
-
Predicted Molecular Mass
28.9 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
