Prolactin Receptor Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Prolactin Receptor Protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin Receptor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Prolactin Receptor Protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Prolactin Receptor Protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin Receptor Protein, Mouse (HEK293, His) is the recombinant mouse-derived Prolactin Receptor Protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The Prolactin Receptor Protein serves as a receptor for the anterior pituitary hormone prolactin. It engages in crucial interactions with SMARCA1, NEK3, and VAV2, with the latter two interactions being prolactin-dependent. These molecular associations underscore the receptor's role in transducing signals triggered by prolactin, a hormone central to various physiological processes, particularly those related to reproduction and lactation. The interactions with SMARCA1, NEK3, and VAV2 highlight the intricate regulatory network that orchestrates cellular responses in a prolactin-dependent manner.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q08501 (Q20-D229)
-
Molecular Construction
-
N-term
-
Prolactin R (Q20-D229)
Accession # Q08501 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PRLR; HPRLrI; Prolactin Receptor; PRL-R; Secreted Prolactin Binding Protein; MFAB; HPRL Receptor; HPRL; RI-PRLR
-
AA Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD
-
Predicted Molecular Mass
25.6 kDa
-
Molecular Weight
Approximately 33-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.2 μm filtered solution of 20 mM Cirate, 6% sucrose, 4% Dextran-70, 50 mM NaCl, 0.05% Tween 80, pH 3.5.
2.Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 6% sucrose, 5% mannitol, 50 mM NaCl, 0.05% Tween 80, pH 3.5.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)