Prolactin R Protein, Mouse (210a.a, HEK293, His)

Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2. The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation. Prolactin R Protein, Mouse (210a.a, HEK293, His) is the recombinant mouse-derived Prolactin R protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Prolactin R Protein, Mouse (210a.a, HEK293, His) is 210 a.a., with molecular weight of 33-40 kDa.

The Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin. It engages in crucial interactions with SMARCA1, NEK3, and VAV2, with the latter two interactions being prolactin-dependent. These molecular associations underscore the receptor's role in transducing signals triggered by prolactin, a hormone central to various physiological processes, particularly those related to reproduction and lactation. The interactions with SMARCA1, NEK3, and VAV2 highlight the intricate regulatory network that orchestrates cellular responses in a prolactin-dependent manner.

Mouse

HEK293

C-6*His

Q08501 (Q20-D229)

19116  [NCBI]

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

33-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Cirate, 6% Sucrose, 4% Dextran-70, 50 mM NaCl, 0.05% Tween80, pH 3.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.