Prolactin Protein, Human (sf9, His)
Based on 1 Customer Validation
Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (sf9, His) is the recombinant human-derived Prolactin protein, expressed by Sf9 insect cells , with C-10*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Prolactin Protein acts on the mammary gland, promoting lactation through its interaction with the receptor PRLR. Prolactin Protein, Human (sf9, His) is the recombinant human-derived Prolactin protein, expressed by Sf9 insect cells , with C-10*His labeled tag.
Background
Prolactin is a protein that primarily acts on the mammary gland by promoting lactation. It achieves this by interacting with its receptor, PRLR.
Verified Bioactivity
1.Measured by its ability to promote proliferation of INS-1 cells and the ED50 is typically 5.6 ng/mL.
2.Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.6-1.0 ng/mL.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-10*His
-
Accession
P01236 (L29-C227)
-
Molecular Construction
-
N-term
-
Prolactin (L29-C227)
Accession # P01236 -
10*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin
-
AA Sequence
LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, pH 8.0, 20% glycerol.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, pH 8.0, 10% glycerol.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
