1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Prolactin
  5. Prolactin Protein, Mouse (His)

Prolactin Protein, Mouse (His)

Cat. No.: HY-P700261
COA Handling Instructions

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process. Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Prolactin Protein, Mouse (His) is 197 a.a., with molecular weight of ~23 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample (2 μg)   Apply now
2 μg $35 In-stock
10 μg $71 In-stock
50 μg $200 In-stock
100 μg $340 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process. Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Prolactin Protein, Mouse (His) is 197 a.a., with molecular weight of ~23 kDa.

Background

Prolactin is a protein that plays a pivotal role in promoting lactation by primarily acting on the mammary gland. It achieves this by interacting with its specific receptor, PRLR, which facilitates the lactation process.

Biological Activity

Measured in a cell proliferation assay using Nb211 rat lymphoma cells.The ED50 for this effect is 4.279 ng/mL, corresponding to a specific activity is 2.336×105 units/mg.

  • Measured in a cell proliferation assay using Nb211 rat lymphoma cells.The ED50 for this effect is 4.279 ng/mL, corresponding to a specific activity is 2.336×105 units/mg.
Species

Mouse

Source

E. coli

Tag

N-6*His

Accession

P06879 (L30-C226)

Gene ID

19109  [NCBI]

Molecular Construction
N-term
6*His
Prolactin (L30-C226)
Accession # P06879
C-term
Synonyms
Prl; Prolactin; PRL
AA Sequence

LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

Molecular Weight

Approximately 23 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin Protein, Mouse (His)
Cat. No.:
HY-P700261
Quantity:
MCE Japan Authorized Agent: