Copy Link Print Information

Prolactin Protein, Mouse (His)

5 Cited Publications
Customer Review

Based on 5 publication(s) in Google Scholar

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process.Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Prolactin Protein, Mouse (His)
  • Experimental Validation Results for Prolactin Protein, Mouse (His)
  • Prolactin Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Prolactin Protein, acting on the mammary gland, plays a pivotal role in promoting lactation through interaction with its receptor, PRLR, facilitating the lactation process.Prolactin Protein, Mouse (His) is the recombinant mouse-derived Prolactin protein, expressed by E.coli , with N-6*His labeled tag.

Background

Prolactin is a protein that plays a pivotal role in promoting lactation by primarily acting on the mammary gland. It achieves this by interacting with its specific receptor, PRLR, which facilitates the lactation process.

Verified Bioactivity

1.Measured in a cell proliferation assay using Nb2-11 rat lymphoma cells.The ED50 for this effect is 0.3921-4.279 ng/mL.
2.Mouse Prolactin Receptor captured on CM5 Chip can bind Mouse Prolactin with an affinity constant of 10-20 nM as determined in SPR assay.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession

    P06879 (L30-C226)

  • Gene ID
    19109  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • Prolactin (L30-C226)
      Accession # P06879
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PRL; PPRL; Prolactin; GHA1; Luteotropic Hormone; Decidual Prolactin; Prolactin Peptide; Growth Hormone A1; Luteotropin

  • AA Sequence

    LPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC

  • Predicted Molecular Mass

    23.2 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Nb211 rat lymphoma cells.The ED50 for this effect is 4.279 ng/mL, corresponding to a specific activity is 2.336×105 units/mg.

  • Prolactin Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for Prolactin Protein, Mouse (His)
  • Experimental Validation Results for Prolactin Protein, Mouse (His)
  • Prolactin Protein, Mouse (His) Product Image