1. Recombinant Proteins
  2. Receptor Proteins
  3. Prolactin R Protein, Mouse (HEK293, His-Fc)

Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin R Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived Prolactin R protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin and significantly interacts with SMARCA1, NEK3, and VAV2.The latter two interactions are prolactin-dependent, emphasizing the role of the receptor in transducing prolactin-induced signals that are critical for multiple physiological processes, particularly in reproduction and lactation.Prolactin R Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived Prolactin R protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

The Prolactin R protein serves as a receptor for the anterior pituitary hormone prolactin. It engages in crucial interactions with SMARCA1, NEK3, and VAV2, with the latter two interactions being prolactin-dependent. These molecular associations underscore the receptor's role in transducing signals triggered by prolactin, a hormone central to various physiological processes, particularly those related to reproduction and lactation. The interactions with SMARCA1, NEK3, and VAV2 highlight the intricate regulatory network that orchestrates cellular responses in a prolactin-dependent manner.

Species

Mouse

Source

HEK293

Tag

C-hFc;C-His

Accession

Q08501 (Q20-D229)

Gene ID
Molecular Construction
N-term
Prolactin R (Q20-D229)
Accession # Q08501
hFc-His
C-term
Protein Length

Extracellular Domain

Synonyms
Prolactin receptor; PRL-R; Prolactin R
AA Sequence

QSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYSKEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKD

Predicted Molecular Mass
52.5 kDa
Molecular Weight

Approximately 65-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Prolactin R Protein, Mouse (HEK293, His-Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Prolactin R Protein, Mouse (HEK293, His-Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin R Protein, Mouse (HEK293, His-Fc)
Cat. No.:
HY-P73694
Quantity:
MCE Japan Authorized Agent: