1. Recombinant Proteins
  2. Receptor Proteins
  3. Prolactin R Protein, Rat (HEK293, His)

Prolactin R Protein, Rat (HEK293, His)

Cat. No.: HY-P73693
COA Handling Instructions

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $35 In-stock
5 μg $40 In-stock
10 μg $65 In-stock
50 μg $180 In-stock
100 μg $290 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Prolactin R protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin R Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin R protein, expressed by HEK293 , with C-His labeled tag.

Background

Prolactin R Protein serves as a receptor specifically designed for the anterior pituitary hormone prolactin. Through its binding with prolactin, this receptor initiates signaling cascades that modulate various physiological processes. Notably, Prolactin R Protein interacts with SMARCA1, indicating potential involvement in chromatin remodeling processes. Furthermore, its interactions with NEK3 and VAV2 are prolactin-dependent, suggesting a dynamic and regulated interplay in response to prolactin stimulation. These molecular interactions highlight the receptor's multifaceted roles in mediating cellular responses to prolactin and underscore its significance in regulating diverse cellular functions.

Biological Activity

Measured by its ability to inhibit Prolactin-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.01808 µg/mL in the presence of 0.5 ng/mL of recombinant human Prolactin, corresponding to a specific activity is 5.531×104 units/mg.

  • Measured by its ability to inhibit Prolactin-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.01808 µg/mL in the presence of 0.5 ng/mL of recombinant human Prolactin, corresponding to a specific activity is 5.531×104 units/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

P05710 (Q20-D229)

Gene ID
Molecular Construction
N-term
Prolactin R (Q20-D229)
Accession # P05710
His
C-term
Synonyms
Prolactin receptor; PRL-R; Prolactin R
AA Sequence

QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD

Molecular Weight

Approximately 32-41 kDa due to the glycosylation

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Prolactin R Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Prolactin R Protein, Rat (HEK293, His)
Cat. No.:
HY-P73693
Quantity:
MCE Japan Authorized Agent: