Prolactin Receptor Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Prolactin Receptor Protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin Receptor Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin Receptor Protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Prolactin Receptor Protein is a receptor for prolactin and can initiate signaling cascades to regulate physiological processes.Interacting with SMARCA1, it may be involved in chromatin remodeling.Prolactin Receptor Protein, Rat (HEK293, His) is the recombinant rat-derived Prolactin Receptor Protein, expressed by HEK293 , with C-His labeled tag.
Background
Prolactin Receptor Protein serves as a receptor specifically designed for the anterior pituitary hormone prolactin. Through its binding with prolactin, this receptor initiates signaling cascades that modulate various physiological processes. Notably, Prolactin Receptor Protein interacts with SMARCA1, indicating potential involvement in chromatin remodeling processes. Furthermore, its interactions with NEK3 and VAV2 are prolactin-dependent, suggesting a dynamic and regulated interplay in response to prolactin stimulation. These molecular interactions highlight the receptor's multifaceted roles in mediating cellular responses to prolactin and underscore its significance in regulating diverse cellular functions.
Verified Bioactivity
Measured by its ability to inhibit Prolactin-induced proliferation of Nb2-11 rat lymphoma cells. The ED50 for this effect is 0.01808 µg/mL in the presence of 0.5 ng/mL of recombinant human Prolactin, corresponding to a specific activity is 5.531×104 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
P05710 (Q20-D229)
-
Molecular Construction
-
N-term
-
Prolactin R (Q20-D229)
Accession # P05710 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PRLR; HPRLrI; Prolactin Receptor; PRL-R; Secreted Prolactin Binding Protein; MFAB; HPRL Receptor; HPRL; RI-PRLR
-
AA Sequence
QSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKD
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
