PRPS2 Protein, Human (HEK293, His)
The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (HEK293, His) is the recombinant human-derived PRPS2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PRPS2 protein plays a key role in catalyzing the synthesis of phosphoribosyl pyrophosphate (PRPP), a key intermediate in nucleotide synthesis. By promoting the conversion of ribose 5-phosphate and ATP to PRPP, PRPS2 contributes to the availability of PRPP in various cellular processes, including de novo biosynthesis of purine and pyrimidine nucleotides. PRPS2 Protein, Human (HEK293, His) is the recombinant human-derived PRPS2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Phosphoribosylpyrophosphate Synthetase 2 (PRPS2) is an enzyme crucial for nucleotide biosynthesis as it catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP). PRPP serves as a key precursor in the de novo biosynthesis of purine and pyrimidine nucleotides, essential for DNA and RNA synthesis. The enzymatic activity of PRPS2 involves the transfer of pyrophosphate from ATP to ribose 5-phosphate, forming PRPP. This reaction represents a critical step in the purine and pyrimidine salvage pathways, providing the necessary building blocks for cellular nucleotide pools. The role of PRPS2 in synthesizing PRPP underscores its significance in supporting fundamental cellular processes, including the maintenance of genetic material and cellular proliferation.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P11908-1 (P2-L318)
-
Molecular Construction
-
N-term
-
PRPS2 (P2-L318)
Accession # P11908-1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRPS2; Testicular Secretory Protein Li 41; Phosphoribosyl Pyrophosphate Synthetase 2; Ribose-Phosphate Diphosphokinase; Phosphoribosyl Pyrophosphate Synthase II; PPRibP Synthetase; Ribose-Phosphate Pyrophosphokinase 2; PRS II; Ribose-Phosphate Diphosphoki
-
AA Sequence
PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPL
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
